(data stored in ACNUC7421 zone)

EMBL: CR954246.PE407

CR954246.PE407       Location/Qualifiers
FT   CDS_pept        complement(437254..440052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0423"
FT                   /product="putative orphan protein ; putative phage
FT                   integrase family"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85521"
FT                   /db_xref="GOA:Q3IIE6"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIE6"
FT                   /protein_id="CAI85521.1"
FT                   /translation="MSKQFIEKQANKINDYLVHTWPHSTAQEAILWILNNLPVVSTQTP
FT                   SLDHSELSIINKKIDTIPTGNQRVYRKALDGVLFYLGNECQWQLPEKIEEKIIDADHEY
FT                   FDDLTKGTAHAQQIFTRYQQRKVLFFTTRPPLTPCFTALMIGFEIAPLSLVHICAILNN
FT                   TDSITDEVSNPRLAITHFECGTDKPQVTHYHLPIICYRLLRDYYAQYPEKITVTRLYNH
FT                   LAQWLEERGLSGVKQGEWPRRFQISWYTRFKLPPIFIKDLAYPERHVGIPCDINPSTIK
FT                   AEDIYAIDWDTKWFDSLKKSRTKIHWPHEILLKHSENPNAVEPPSWDAANILPRLLFNY
FT                   TKQLIVFGGVKKANLALDSIKNYTSLKSKLELFPLSYADAINEEAVNKWAETVYDSIDS
FT                   DIVKVTFYNFLRFLKHQEQTDTLDLSLFSSPLIPPSVSPARLGVDECDLLIKTLIESES
FT                   NHPFRSLFCIVAALLGFYAMLRRGEVLRLRRKDIRFKPSTGLITIIVTNTPEGNTKSNT
FT                   TRKVYTTLPKQYHPLFKSLFKIKKRNIDREQPLLGFKGEMYHSRQLYYLLPVSRALRFL
FT                   FGAHLNFHHLRHSGVHLFMLQTLHCLNNTPNEQRGEIPLEQEVLSSTSVATRFNYWFEG
FT                   REVDEVNDAAFLDEMGKQIGHIYYGTTRWSYLHDIDWLLPIISRAHSPYTGREYTHSEL
FT                   RYLFGLKPDSNDLSRILLKLSPKYANKNLGQKRSQPIMLRDCKLREAVFGKAIQSKHTP
FT                   LTVDHNLDWQKSIHNSEHSLLGFIFKAMLKSKTLDLYALSFIWGNGNKHHIQPISKKQH
FT                   TALNNLPPIVLSDDKQSLQITLACNSKNARAFSSVFRQADWGWLNIKFILSVNRKINSE
FT                   RQVMLLKTLFVQKNEVIQIAKHLRGKTQLTIYLIPKKTLPSNVLKFVQSFIQLFQYYEA
FT                   KQ"
     atgtctaaac agtttataga aaagcaggcc aataaaataa atgactactt agtgcatact        60
     tggccacaca gtacagcaca agaggctatc ttatggatat taaataatct gcctgtggtg       120
     agtacacaaa cgcctagttt agatcatagt gagctaagca taatcaataa aaagatcgat       180
     accattccga cagggaacca acgagtctat cgaaaggcac tagatggcgt tcttttctat       240
     ttaggaaatg aatgtcagtg gcaactgcct gaaaaaatag aagaaaagat aatagatgca       300
     gatcacgagt actttgatga ccttacaaaa ggtactgcgc atgcacagca aatttttacc       360
     cgctatcaac aacgtaaagt actttttttt actacaaggc cgccattaac accgtgcttt       420
     actgcactaa tgatagggtt tgaaatcgcg cctttatcgt tagtgcatat ttgtgcaatc       480
     ttaaataaca ctgattcaat cacggatgaa gtatccaatc cacgtcttgc tataacgcat       540
     tttgaatgtg gtactgataa gccacaagta acgcattacc atcttccaat aatatgctac       600
     cgactattgc gtgattatta tgcacaatac cctgaaaaga taacagtaac gaggttatat       660
     aatcacttag ctcagtggtt agaagagaga ggattgtctg gggttaaaca aggtgagtgg       720
     ccaagacgtt ttcaaataag ctggtacaca cgctttaaac taccgcctat ttttataaaa       780
     gatctagcct atcctgagcg ccatgtcggt ataccttgtg acattaaccc atccacaata       840
     aaagcggaag atatttatgc tattgactgg gataccaagt ggtttgactc actaaaaaaa       900
     tcaagaacta aaattcattg gcctcatgaa atactactca agcattcaga aaatccgaat       960
     gctgtagagc ccccttcatg ggatgcagct aatattttac cgcgattgct gtttaattat      1020
     actaaacagt taatcgtgtt cggtggggtt aaaaaagcaa atcttgcctt agattcaatt      1080
     aaaaattaca cttcactaaa aagtaagctt gaactcttcc ctttatctta tgctgatgca      1140
     attaacgaag aagccgttaa taagtgggct gagactgttt atgactcaat agactccgat      1200
     atagtaaagg taacatttta taatttttta cgatttttaa agcaccaaga acaaacagat      1260
     acgctcgatt tatccctatt tagtagcccg ctaataccac catcagtgag ccctgctcgc      1320
     ttgggcgttg atgaatgtga tttattgata aaaacactga tagaaagtga atcaaaccac      1380
     ccatttcgca gtttgttttg tatcgttgct gctttgctcg gtttttacgc tatgctgcgc      1440
     cgtggtgaag tccttagatt acgtcgtaaa gatattcgct ttaaaccaag tactggcctt      1500
     ataacgatta tcgtaacaaa cacccctgaa ggcaacacta aaagcaatac tacacgcaag      1560
     gtatacacta cacttcctaa gcagtatcac ccgttattta aatctttatt taagataaaa      1620
     aaaaggaaca tagatcgtga gcagcctttg ttgggattta aaggtgaaat gtatcattca      1680
     cggcagcttt attatttatt acctgtgtca cgtgctttac gatttttgtt tggtgcacat      1740
     ctaaattttc accaccttcg ccacagtggc gtgcatctat ttatgttgca aactctgcat      1800
     tgccttaata atacacccaa tgaacaacga ggagaaatac cccttgagca agaggtgcta      1860
     tcgagtacgt cggtggctac tcgctttaat tattggtttg aagggcgaga ggttgacgaa      1920
     gttaatgatg ctgcattttt ggatgaaatg ggtaaacaaa ttggtcatat ttattatggc      1980
     actacacgct ggtcatactt gcatgacata gattggctac tgcctatcat tagccgtgct      2040
     cattcaccgt atacagggcg cgaatacaca cacagcgagc tgcgctattt gtttggacta      2100
     aaacctgact ctaatgatct ttctcgcata ttacttaagc tcagccctaa gtacgccaac      2160
     aaaaatctgg ggcaaaaacg tagtcagcca atcatgctgc gcgattgtaa gcttagagaa      2220
     gccgtatttg gtaaagctat tcaatcaaaa catacgcctt tgacagttga ccacaattta      2280
     gattggcaaa agtcaattca taacagcgaa cactcgttac tcggtttcat atttaaagct      2340
     atgttaaaga gtaaaacgct tgacctatat gcactaagtt ttatttgggg taatggcaat      2400
     aagcatcata tccaaccgat cagtaaaaag cagcacacag cgctaaacaa cttacctccc      2460
     attgtacttt ctgatgataa gcagtcatta caaatcacgc ttgcctgcaa cagcaagaat      2520
     gcacgcgcgt ttagctctgt gtttagacag gctgactggg ggtggctaaa tattaaattt      2580
     attctttcag ttaatcgaaa aatcaacagt gaacgacaag taatgttgct taaaacattg      2640
     tttgttcaaa aaaacgaagt tattcaaata gctaaacacc ttagaggtaa aacgcaattg      2700
     actatttatt taatccccaa aaaaacgctt ccatctaatg tgctcaaatt tgtacaaagt      2760
     tttattcaat tatttcaata ttatgaggcc aaacaatga                             2799
//

If you have problems or comments...

PBIL Back to PBIL home page