(data stored in ACNUC7421 zone)

EMBL: CR954246.PE408

CR954246.PE408       Location/Qualifiers
FT   CDS_pept        complement(440045..441622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0424"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85522"
FT                   /db_xref="GOA:Q3IEH6"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEH6"
FT                   /protein_id="CAI85522.1"
FT                   /translation="MSISKHIARSNRLKNAGGCYPDALPYATTLAILLAKLAKVDVKTR
FT                   PAITVVALFMWLTEDWRIIDKPDDIPDFIRISGASPCRQYAFRNYYDSTVSWTEYARAC
FT                   KDKNKTTYLWQPIPTYLNQFFQTFISEKTYDTPFLTQKAKTILFELMSKAWKTPHKLQG
FT                   QPRVRKDSLQNYFIKCAQADNTLGAIVRVQLIADQQAHHRSARYYQQQSSDRIRRKIFD
FT                   AHNRYLSRLIAAARNAKINSYFVVYLKSYSVSLIKDNHEKAKYLSIPGIIKQFELDTSQ
FT                   NGESKVCTPAIMLGSRRSLDDKNVSLFFQSLQKEVEDAKESIYVKCSSQKSSSANHAAL
FT                   RDYYNKATYRIALLFIVLTGARPTHSISILSDYYSGSDITFIKDKGVLRQLILCDYLQQ
FT                   EIKHYLSLQTVIRSQLNIHTELDELWYTCNEKNIPIALTCRELRLFMHKLWPGVVPYHL
FT                   RHFYCHCANSHMFSDKLFDNDIDRLMGHENLGERLGSDILSPRRFALMKDYLNMLSQRI
FT                   GLEALIHV"
     atgagcatat cgaaacatat tgcaagaagt aaccgtttaa aaaatgctgg tggctgttat        60
     ccagatgcgc tgccatatgc aacaacgctc gctattttgt tggctaaatt agcgaaagta       120
     gacgttaaaa cacgtcctgc aataaccgtt gttgcactat ttatgtggct aacagaggac       180
     tggcgtatta ttgataaacc agatgatatt cctgatttta taagaatttc aggcgctagc       240
     ccctgtcgtc aatatgcatt tcgtaactac tatgacagca cggtatcgtg gacagaatat       300
     gcccgtgcat gcaaagataa aaataaaact acgtatctgt ggcagcctat acctacttac       360
     ctaaatcagt tttttcaaac gtttattagc gaaaaaacct acgatactcc ttttttaact       420
     caaaaagcta aaacaatctt gttcgagtta atgtctaagg cttggaaaac acctcataaa       480
     ttacagggcc aaccccgtgt acgtaaagac agcctgcaaa attactttat aaaatgcgct       540
     caggcagaca atacgttggg tgcaattgta agagtacaac ttattgcaga tcaacaagct       600
     catcatagga gcgctaggta ttatcagcag caaagtagtg atcgcatccg cagaaaaata       660
     tttgatgcgc ataaccgcta tctatcacgg cttatagctg cagcaagaaa cgccaaaatt       720
     aattcgtatt ttgtggttta tctaaaaagc tattcagtga gcctaatcaa agacaaccat       780
     gaaaaagcca aatatttatc aataccgggg attataaaac agtttgaact tgacacctcg       840
     cagaatggag aaagcaaagt atgtactcct gcaattatgt taggaagccg ccgttcgttg       900
     gatgataaaa atgtgagtct gttttttcag tcacttcaaa aagaggttga agatgccaaa       960
     gagagtattt atgtaaaatg ctcaagccaa aaatcgtcgt cagccaatca tgcagcgttg      1020
     cgcgattact ataataaagc aacctatcgt attgcattac tgtttattgt tcttaccggc      1080
     gcaagaccta cacatagtat cagtatttta tcagattatt attcaggatc tgatattacc      1140
     tttattaaag acaaaggtgt tcttagacaa ctgatactct gtgattactt gcagcaggaa      1200
     attaagcact acttatcact tcaaacagtt attcgttcgc aacttaacat tcatactgaa      1260
     ttagatgagc tctggtatac atgtaatgaa aaaaatatac cgatagctct cacatgtcgt      1320
     gagcttcgct tattcatgca taaactatgg cctggtgtgg tgccttatca tttgcgtcac      1380
     ttttattgtc attgcgctaa tagtcatatg ttttcagaca agctgttcga taacgacatt      1440
     gatcgtctca tgggccatga aaatctgggg gagcgcctcg gaagtgacat attatcgcca      1500
     agacgttttg ctttgatgaa ggactattta aatatgctat cgcagcgcat tggtttggag      1560
     gcgttaattc atgtctaa                                                    1578
//

If you have problems or comments...

PBIL Back to PBIL home page