(data stored in ACNUC7421 zone)

EMBL: CR954246.PE409

CR954246.PE409       Location/Qualifiers
FT   CDS_pept        complement(441636..442109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0425"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85523"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEH5"
FT                   /protein_id="CAI85523.1"
FT                   /translation="MRYKQKSIPFDNAKLQVHPLLVTLTKNDVTQLKVNQCIGELPIEV
FT                   IQTLLDLNPLPVALSTDDDCYLTLAPSGILERFKAHPLSKKLSLKLYVYPTDAIEHVLS
FT                   VTLLYNYAVTLYLKNGFSTNIQRRLSCFKEHGIHAPKKTILANLANTSPSIFR"
     atgcgctata aacaaaaatc aatccctttt gacaatgcga aattacaggt ccatccgcta        60
     cttgttacgc ttacaaaaaa tgatgtgacg cagctaaaag taaaccaatg cattggcgag       120
     ttacccattg aggtaataca aacgttatta gatttaaacc cacttccagt ggcgcttagt       180
     actgatgatg attgctacct gacacttgca cctagcggaa tactagagcg ctttaaggcc       240
     caccctttga gtaaaaagct ctccttaaaa ctatacgttt acccaacaga tgctattgag       300
     cacgtgctaa gcgttacctt gctatataac tatgctgtca cgctttattt aaaaaacggt       360
     ttcagtacta atattcagcg ccggcttagt tgttttaaag agcacggtat acacgcccct       420
     aaaaaaacga tattggcaaa cttagctaat acctcacctt ctatttttcg gtag             474
//

If you have problems or comments...

PBIL Back to PBIL home page