(data stored in ACNUC7421 zone)

EMBL: CR954246.PE41

CR954246.PE41        Location/Qualifiers
FT   CDS_pept        46871..47056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0045"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85155"
FT                   /db_xref="GOA:Q3IF13"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF13"
FT                   /protein_id="CAI85155.1"
FT                   /translation="MNIILIAYLLIFALFGTAASYFVRFIYAYWVLNKMPMHYIIKAGI
FT                   CLVMVVIISALIPYLG"
     gtgaatataa ttttaattgc ttacttacta atttttgcat tatttggtac tgcggcaagc        60
     tactttgtgc gttttattta tgcgtattgg gtgcttaaca aaatgccaat gcactatatt       120
     attaaagcgg ggatttgttt agtaatggtg gtaattattt cagcgttaat cccatattta       180
     ggataa                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page