(data stored in ACNUC7421 zone)

EMBL: CR954246.PE410

CR954246.PE410       Location/Qualifiers
FT   CDS_pept        443258..444010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0426"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85524"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEH4"
FT                   /protein_id="CAI85524.1"
FT                   /translation="MSTLKSSNRIAFSTLNYPLDKKENRSINVANSMLYQIKKLGITIK
FT                   DEKFLLSFTKSLNEVERDPSAPHLCFDHDPRRTAQFLQRLKINLSESGQNFSLSKLGYL
FT                   LALTLGFDKYDGLLKQLDAYQCFIKKPWYIYGKKITKPLIRHNGKDTYIFLPLMSISPS
FT                   SRYMTQDMSVSIILASDLKTIGCPIIFSYRKESHGCEFRSFGTTQEDAMAWLIVHAIHQ
FT                   LQDVRLWNVELNYHRATARYEAEKEKFE"
     atgtcaactt taaaaagtag caatagaatt gctttttcaa cccttaacta ccccttagat        60
     aaaaaagaaa accgttcaat taatgtagcc aacagcatgc tttatcagat aaagaagtta       120
     gggattacaa ttaaagacga gaaattctta ttatcattta ctaagtcgct taatgaagta       180
     gaaagagacc cttcagctcc tcacctttgt tttgaccacg atccacgacg tactgcgcaa       240
     tttttacaac gattaaagat caatttatca gagagcgggc aaaacttcag cctatcaaaa       300
     ttaggctact tgttagcgct aacactaggg tttgataagt atgatggcct gctcaagcag       360
     ctagatgcgt atcaatgttt tattaaaaag ccgtggtata tatacggaaa aaaaattacc       420
     aaacctttaa taaggcataa tggcaaagat acttatatat ttttgcccct aatgtccatt       480
     tcaccttcat ctaggtacat gacacaggat atgtcagtaa gcataatttt ggctagcgat       540
     ctaaaaacga taggatgtcc aatcattttt tcatatagaa aagagtccca tggctgtgaa       600
     tttcgaagtt tcgggacgac tcaagaggac gctatggcat ggctgatcgt ccatgctata       660
     catcaacttc aagatgttag actatggaat gttgaattaa actatcatcg agcgactgcg       720
     cgctacgagg ctgaaaaaga aaagtttgaa taa                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page