(data stored in ACNUC7421 zone)

EMBL: CR954246.PE411

CR954246.PE411       Location/Qualifiers
FT   CDS_pept        complement(444374..445306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0427"
FT                   /product="putative transcriptional activator for lysine
FT                   biosynthesis (LysR family)"
FT                   /function="2.2.1.2 : Aspartate family"
FT                   /function="3.2.1.1.1 : Regulatory proteins (DNA
FT                   interaction)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 6350602; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85525"
FT                   /db_xref="GOA:Q3IEH3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEH3"
FT                   /protein_id="CAI85525.1"
FT                   /translation="MQQNQQKITLNSLEAFDAVIKTGSATGAAKLLGLTQPGISRLIAQ
FT                   LESKVGFSLFYREKARLFPTDEAVALHKQVETSLASVYRVEQLAKNIHQSHVGHLNIVA
FT                   PSSFVAGPLAEAVASFLKDHPNVKINLDSHSPARACELVANKAFDCGFIQLPENHDNLL
FT                   CEPIISSNLVCAVSSSHPFASARELQPEDLRDESLVLLGQGRHSRRRIEHAFLQSNVRL
FT                   KVRVETHTVPTACTLAKHGVGISIVNKLIAQQFQNDDLKLIPFKPEIEIVYGFITSTSA
FT                   PMNRLTQTFYNHCKVHFSQFMDSCGLSEK"
     atgcaacaga accaacaaaa aattactttg aacagcttgg aagcgtttga cgcagtaata        60
     aaaacaggct ctgcaacagg ggctgctaaa ttattaggct taactcaacc tggtattagt       120
     cgacttattg cacagcttga aagtaaagtt ggtttttctt tattttatcg agagaaagca       180
     cgtttatttc ctactgatga agcagttgcc ttacataagc aagtagaaac gtcgttagca       240
     agtgtgtacc gagtggaaca actagcaaaa aatatccatc aatcgcatgt aggccatctc       300
     aatattgttg ctcctagcag ttttgttgcg ggacctttgg ccgaagccgt tgcatcattt       360
     ttaaaagatc acccaaatgt aaaaattaac ttagatagtc acagtcctgc tagggcttgt       420
     gagttagttg caaataaagc attcgattgt ggttttatac agcttcctga aaatcatgat       480
     aatttacttt gtgaacctat aattagtagt aatctggtgt gcgcggtatc aagtagccat       540
     ccttttgcta gtgctcgaga acttcagcct gaagatttac gagatgaaag cctagtatta       600
     cttggacaag gacgacattc gcgcaggaga attgagcatg catttttaca aagcaatgtt       660
     cgcttaaaag taagagtgga aacacatact gtacccacgg cttgtacatt ggctaaacat       720
     ggggtgggta tttcgattgt aaacaagctg atagctcaac agtttcaaaa tgatgactta       780
     aaacttatcc cttttaagcc tgaaatagaa attgtttatg gttttattac ttctacatca       840
     gcccctatga ataggctgac tcagacattt tataatcact gcaaagtgca ttttagtcag       900
     ttcatggata gctgtgggtt aagcgaaaag taa                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page