(data stored in ACNUC7421 zone)

EMBL: CR954246.PE412

CR954246.PE412       Location/Qualifiers
FT   CDS_pept        445425..448136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0428"
FT                   /product="putative TonB-dependent receptor"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85526"
FT                   /db_xref="GOA:Q3IEH2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEH2"
FT                   /protein_id="CAI85526.1"
FT                   /translation="MERLMFKQSVISLAIATACLTASHTVSAEDVTAEKSVERIAVTGS
FT                   RIKRQSATASPIQNIDLETLNANGSLSLGDALQELPSVGSSLNGNGSAGSSHGSSSLNL
FT                   RNLGANRSLVLVNGHRWVNGAGSRGFRDFVDMNTIPQAIIKRVEVLQDGATAIYGADAI
FT                   AGVVNLYTYDDYEGLEVKTTYGETTKSDRETFNIDILSGVNINDGNLMFAASHVDQKPI
FT                   YTQDRNITAVPLNGLTSATPEGHFFEDNLATVNGLTPSSGGITRDPGKDGNNIDNWRKV
FT                   NSDDTYNRYYNNYVTGPSERSSLYTQLVMPIGSVNFKAEALYNSRESDQQFSPALSPIR
FT                   GSRGFVIADDARVNPFGVEFSGSDFKHNAFFMNNGYRVNEQKVETTRFAIGLDGELSND
FT                   WSWDSFASWASNKGEFTSNNQMNLDKLALGLRACDTTGIDADVTDLVSGCVPVNIFAPL
FT                   TDDMVNYINFTGHDKNEASQLDFTANITGSLYELPAGYIGAAFGIEYRKEKGEDTPDSI
FT                   INSDPRINTYRTTTSSPREGTIGEYDLKEAYAEFSIPLLDDKPLAEYLELSLAVRYSDY
FT                   STFGSTTNSKVGLLYTPFEQLTLRANWAEGFRAPSILELFEGERLTYKAVNDPCSTDNN
FT                   LAGCSGVPTDYSQPFSNVQVTTGGNRQLVPETSKNKTVGLIYESNLIENLSFTLDWYEI
FT                   EINNTISEFGAQNNLDLCAYQNKNCDTITRDSSGEIIDILDGPVNLNATRVSGIDFVSY
FT                   YTLQTDFGDWSFNANVSKLNTLTEYSTLSDGSIEQEDLVGTAASRESYPEWRGTFSSTW
FT                   KYNGWTANYNLRHIDSTTEQFLGEPRGIGSVTYHNISGGYQFANNLSVKLGVNNLGDKQ
FT                   PPASLTNLNINFDQNTYNPVGRYMYLQLTYSL"
     atggaacgtt taatgtttaa gcaatccgta atatcactcg ccattgctac agcatgccta        60
     actgcgagtc atactgtatc agctgaagac gtaacggcag aaaaaagtgt cgaaagaatc       120
     gcagtaactg gttcgcgtat taaacgccaa tctgcgacag caagtccaat acaaaatatt       180
     gatttagaga cattaaatgc taatggttcg ctctcattag gtgatgcatt gcaagaactt       240
     ccttcagttg gctccagctt aaatggtaat ggctcagcag gctctagtca cggttcatct       300
     agtttaaatt tacgtaattt aggtgctaac cgctccttag tgcttgttaa cggtcatcgc       360
     tgggtgaatg gtgccggttc acgcggcttt cgtgacttcg ttgatatgaa tacgattcct       420
     caagccatta ttaaacgcgt agaagtactt caagatggtg ctacagcaat ttatggtgca       480
     gacgctattg ccggtgtagt gaacctgtat acctatgatg actatgaagg gcttgaagta       540
     aaaactacct atggtgaaac aactaaaagc gacagagaaa cgttcaatat tgatatttta       600
     tctggtgtca atattaacga tggcaactta atgttcgctg caagccatgt tgatcaaaag       660
     cctatttata cacaagatag aaatataacc gcggttccat taaatggatt aacgtcagcg       720
     acaccggaag ggcatttctt cgaagataat ttagcgaccg taaacggcct tactccttcc       780
     tcaggaggga taactcgcga tcctggcaag gacggtaata atattgataa ctggcgtaaa       840
     gtgaatagcg atgataccta taatcgttat tacaataact atgtaacagg tcctagcgag       900
     cgttcttcat tatatacaca attggttatg ccaataggct cagtaaactt taaagctgaa       960
     gcgctgtata attcacgtga atcagatcaa cagttttcac ccgcactatc tccgatccga      1020
     ggaagtcgcg gttttgttat tgctgatgac gcaagggtaa atccttttgg ggttgagttc      1080
     tctggtagcg acttcaaaca taacgctttc tttatgaata atggctatcg agtcaacgag      1140
     caaaaagttg aaacaacacg atttgctatt ggattagacg gtgaactgtc taatgactgg      1200
     tcatgggata gctttgcatc atgggcaagc aataaaggcg aatttacctc taataaccaa      1260
     atgaatttag ataagctagc attaggctta cgtgcatgtg atacgacagg cattgatgcc      1320
     gatgtgacag acttagtttc aggttgtgtg ccagtaaata tttttgctcc actgaccgac      1380
     gacatggtta actatataaa ctttactggc catgataaaa atgaagctag ccaactagac      1440
     tttaccgcaa atattaccgg ctctttatat gaactacccg caggctatat tggtgcagct      1500
     tttggtattg aataccgtaa agaaaagggc gaagacacac ccgacagtat catcaactca      1560
     gatccacgta ttaacactta tagaacaacc acatcttcac ctcgtgaagg gactatcggt      1620
     gaatacgact taaaagaagc ttatgcagag tttagcattc ctcttcttga tgataagcct      1680
     ctcgctgaat atttagagct gagtttagcg gtacgttact cagattacag tacgtttggt      1740
     tcgactacca atagcaaagt tggcttactt tatacaccat ttgagcaact tactttacga      1800
     gcaaactggg ctgaaggctt cagagcgcct tcaattttag aactttttga aggtgaacgc      1860
     ttaacttata aagcagttaa tgatccttgc tctactgata ataatttagc aggttgtagc      1920
     ggtgtgccaa ccgattattc gcagccattt agcaacgtac aagtaacaac aggcggtaac      1980
     cgtcagttag tacctgaaac ttcaaagaac aaaaccgtag gcttgattta cgaatctaac      2040
     cttattgaaa acctaagctt tactttagat tggtatgaga tcgaaataaa taacactata      2100
     agtgagtttg gtgcgcaaaa taaccttgat ttatgtgctt atcaaaacaa aaattgcgac      2160
     accattacgc gagatagtag cggtgaaatc atagatattt tagatggccc ggttaatctt      2220
     aatgcgacac gtgtttcagg cattgatttt gtctcatatt acacgttgca aacagacttt      2280
     ggtgactggt cgttcaatgc aaatgtatca aaattaaaca ctttaactga atactcgacc      2340
     ctatccgatg gctcaataga gcaagaagat ttagtaggca ctgcagcatc acgtgaatct      2400
     taccctgaat ggcgcggtac tttctcaagt acgtggaaat ataatggatg gacagctaat      2460
     tataaccttc gtcatatcga ctctacgact gagcaatttc taggagagcc tcgcggtata      2520
     ggctctgtga cctatcacaa tatctctggt ggttatcagt ttgcaaacaa ccttagtgtt      2580
     aaattagggg ttaataacct tggcgataag cagccacctg cttcgttaac taatttaaat      2640
     attaactttg atcaaaatac ctataatcca gttggacgtt atatgtattt gcaactcact      2700
     tactcacttt aa                                                          2712
//

If you have problems or comments...

PBIL Back to PBIL home page