(data stored in ACNUC7421 zone)

EMBL: CR954246.PE413

CR954246.PE413       Location/Qualifiers
FT   CDS_pept        448196..449044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0429"
FT                   /product="conserved protein of unknown function ; putative
FT                   N-formylglutamate amidohydrolase family"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85527"
FT                   /db_xref="InterPro:IPR007709"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEH1"
FT                   /protein_id="CAI85527.1"
FT                   /translation="MKSAFSLLTPIESEEIPLVFDSPHSGIHCPDDFNAQVPLEFIKSG
FT                   WDAFIDDIWQPITEKGGYLLHANFSRMYIDPNRAPDDIDPALLDESWDRCKPTKYSDRG
FT                   MGLIRRYALPGKAMYDRKLTREEVTHRIDHYYSPYHTQLQTLLDDLYTRHQGVWHVDCH
FT                   SMKSVGNGMNIDAGIARPDIILGDKDGQSADPEFVNVIAQAFTHKGYKVVKNTPYKGGY
FT                   LVSNYGNVAANRHSVQIEVNRALYMNEKKFEKNENYEQFKRDTSFVAQQLAAYVSAQVG
FT                   K"
     atgaagtcgg ctttcagttt gttaacccca attgagtcag aagaaatacc cttagtgttc        60
     gattcaccac acagcggaat tcattgtccc gatgatttta atgcacaggt acccttagag       120
     tttataaagt cggggtggga tgcctttata gatgatattt ggcaacccat tactgaaaag       180
     ggaggttact tattgcatgc aaatttctca cgtatgtata tagatccaaa tcgtgcgcca       240
     gatgatattg atcccgcatt attagatgag tcatgggatc gatgtaaacc aactaaatac       300
     agcgaccgtg gcatgggctt aattcgtcgt tacgccttac ccggaaaagc catgtatgat       360
     agaaagttaa cgcgagaaga agtaacccat cgtattgatc attactattc gccataccat       420
     acccaactgc agactttatt agatgattta tacactcgac accaaggtgt atggcatgtt       480
     gattgtcact ctatgaagtc agtagggaat ggcatgaaca tcgatgcagg tatagcacgt       540
     cctgacataa ttttgggtga taaagatggc caatcagcag atcctgaatt tgtaaatgtg       600
     attgcccaag cattcactca taaaggctat aaagtggtaa aaaatacacc ctataaaggc       660
     ggatatttag tgagtaatta cggtaatgtc gctgcaaatc gccactctgt acaaatcgaa       720
     gtaaatcgtg ctttatatat gaatgagaaa aaattcgaaa aaaatgaaaa ttatgagcaa       780
     tttaagcgtg atacctcctt tgtggctcaa caattagctg cttatgtgtc tgctcaagta       840
     ggtaaataa                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page