(data stored in ACNUC7421 zone)

EMBL: CR954246.PE414

CR954246.PE414       Location/Qualifiers
FT   CDS_pept        449047..450438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0430"
FT                   /product="conserved protein of unknown function ; putative
FT                   C4-dicarboxylate anaerobic carrier family"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85528"
FT                   /db_xref="GOA:Q3IEH0"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEH0"
FT                   /protein_id="CAI85528.1"
FT                   /translation="MSENNYSNEKKGLNPIIILLGILFLATLLTYIVDSGVYERDDNMV
FT                   VANSYNIIDKDKSLSNLFNYQDADLVKAEPVSIIGTFMAIPSGLEQGSGLIFMVLIIGG
FT                   MFGILTKAGTIDAGLERLLSLVQGNIYVLVILLMIVFSAGSTFLGLASEYLLIIPLMVG
FT                   MANRLGLPNIIGFAIVCVAVKAGYLSSVTNPLPLTIAQPLLGLQIFSGASVRFFFYLAF
FT                   LAVGIGFVLFMIKRQGFKNEQVHFHSEKLSTRHVIILLTLTSGIALLVYASTQWYWKHH
FT                   ALSAYYIALSMVLAAISGLSANQAAQAFVDGMKKVLLASILIGVATAVAVVLKQGMVLD
FT                   SIVHFLMSFIGEGNAYFAATGMFVSQLMLDFLIPSTSGQAAVSMPILGPIGNLAGVSEQ
FT                   TTIVAFLFGNGITNILTPTSGTLLAYLATARVGWGEWAKFIFPLWLIYIVLAIVLLQVS
FT                   VFINF"
     atgagcgaaa ataattatag taatgaaaag aagggcttga accctattat catactgtta        60
     ggtatcttgt ttttagctac gctacttact tatattgttg actcaggagt atatgaaaga       120
     gacgacaata tggtagttgc caacagttat aatattattg acaaagataa gtcgttatca       180
     aacctattta attatcaaga tgcggattta gtaaaagccg aaccggtgag tattattggt       240
     acatttatgg cgatcccttc aggccttgaa caaggctcag ggttaatatt tatggtactt       300
     atcattggtg gtatgtttgg tattcttaca aaggcgggta cgatagatgc agggcttgaa       360
     aggttactga gcttagtaca gggtaatatt tatgtgctcg ttattctgct catgatcgta       420
     ttctccgcag gcagtacgtt tttaggttta gcatctgaat atttacttat aatcccactc       480
     atggttggca tggccaaccg attagggtta cctaatatta taggcttcgc tattgtatgt       540
     gtggcagtaa aggcagggta tttgtcatcg gtgacaaacc cattaccttt aactattgct       600
     caacctctac tcgggctaca aattttcagt ggtgcaagcg tacggttttt cttttatcta       660
     gcatttttag ctgtcggcat tggctttgtg ctttttatga tcaagcgtca aggctttaaa       720
     aatgagcaag tccattttca tagcgaaaaa ctatcaacac gccatgtcat catattactt       780
     actcttacca gtggtattgc tttattagtt tatgcatcaa cacaatggta ttggaaacac       840
     cacgcattaa gcgcctatta tattgcactt agtatggtgc ttgctgctat ttcaggtctc       900
     agtgcaaacc aagctgcgca agcgtttgta gacgggatga aaaaagtgct gcttgctagc       960
     atactcattg gcgtagcaac tgcagttgct gtggtgctaa agcaaggcat ggttttagat      1020
     tcaattgtac attttttaat gtcatttata ggtgaaggta atgcttactt cgctgcgaca      1080
     ggcatgtttg tatcacaatt aatgctagat tttctaattc cttcaacgtc ggggcaagca      1140
     gccgtaagca tgcctatttt agggccaatc ggtaatttag caggcgtatc tgagcaaaca      1200
     acgatagtcg catttttgtt tggtaatggt ataaccaata ttcttacccc tacctcaggc      1260
     actttattag cctacctagc caccgcacga gttggatggg gcgaatgggc taaattcatt      1320
     tttccacttt ggctaattta tatcgtgctt gctattgtat tattgcaagt gtcggtgttc      1380
     atcaactttt aa                                                          1392
//

If you have problems or comments...

PBIL Back to PBIL home page