(data stored in ACNUC7421 zone)

EMBL: CR954246.PE417

CR954246.PE417       Location/Qualifiers
FT   CDS_pept        complement(450673..450897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0433"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85531"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEG7"
FT                   /protein_id="CAI85531.1"
FT                   /translation="MSVSVLFFKYYKGMLRMTIMNSKAQLTVNTIVAVGSAENGIGTVG
FT                   FMTSNASTIANLSFDAGDSLPKSSSAITK"
     gtgtctgtta gtgttttgtt ttttaaatat tataaaggca tgttgaggat gactattatg        60
     aattctaaag ctcaactcac tgttaatact attgtagcag tcggctctgc tgaaaacggc       120
     attggtacag ttggattcat gacatcgaat gcttcaacaa tagcaaatct ttcgtttgac       180
     gctggtgatt cattacctaa atcatcttct gcaattacaa aataa                       225
//

If you have problems or comments...

PBIL Back to PBIL home page