(data stored in ACNUC7421 zone)

EMBL: CR954246.PE419

CR954246.PE419       Location/Qualifiers
FT   CDS_pept        complement(451705..452718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0435"
FT                   /product="putative transcriptional regulator, AraC family"
FT                   /function="3.2.1.1 : Regulation"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85533"
FT                   /db_xref="GOA:Q3IFS9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFS9"
FT                   /protein_id="CAI85533.1"
FT                   /translation="MVRPYVTLNDKFIPVQGLVACLLELAQQRQLNQHKLLRGTGIFDE
FT                   DLLRPDFYLSLSQLLRLLKQFNNLMPGRDAAFQLGHRLFPASSAEASAILHSRNLTQAL
FT                   RLLSCFRLQLAPLLFAHHYKYNDYSYLQLNDAVGLDEQQYQFVVELYCCLLVSASRYML
FT                   GERIPFHFEFPFQRPRHIYEYEEHLGLKLTFGRPSLIVKFAQKWLTSPLLRSSQLHRKL
FT                   AMQQVNRDMLKQTFIEMISNYLHHHRQANLQQVSEHLNMSTATLKRRLKEHNLRFSQLQ
FT                   DRINMQLAFHFLTVQGLSNEVVAEKLAFHDAPNFRRACKRWTGLTPTELKALALSK"
     atggtgcgac catatgtcac gctgaacgat aaatttatac ccgtgcaagg attggtggcg        60
     tgcttactag agcttgccca gcagagacag ttaaatcagc ataaattatt gcgtgggaca       120
     ggcatttttg atgaggattt gctacgccca gatttttacc tgagcctatc gcaactatta       180
     agactactaa aacagtttaa caacttgatg ccaggacgag atgccgcctt tcaacttggt       240
     catcggctat ttcccgcttc tagcgctgaa gctagtgcta ttttacatag tcgaaactta       300
     actcaagccc tgcgcttgtt gagttgtttt agattgcagt tagcgccgct attatttgct       360
     catcattata agtataacga ttatagctat ttgcaactca atgatgcggt tggtttggat       420
     gaacagcaat atcaatttgt agttgagcta tactgttgct tattagtttc ggccagtcga       480
     tacatgctgg gtgaacgtat tccttttcat tttgaatttc catttcaacg cccacgccat       540
     atctatgagt atgaggagca tttaggcctt aaacttacct ttggtcgccc ttctctgata       600
     gttaaatttg cacaaaaatg gctaacctct cctttgttac gatcaagcca attacaccga       660
     aagctggcta tgcagcaagt taatagagac atgttaaaac aaactttcat tgagatgata       720
     agcaattatc tacatcacca tcggcaagct aacttgcaac aagtcagtga gcacttaaat       780
     atgagtaccg caacacttaa acggcgctta aaagaacaca atttacgctt ttcacaattg       840
     caagatcgga taaatatgca actggccttt catttcctta ccgtacaagg gttaagtaac       900
     gaagtcgtgg cagaaaagct cgctttccat gatgcaccaa actttcgtag agcctgtaaa       960
     cgctggacag gtttaacacc cacagagctt aaagcactgg cgcttagcaa ataa            1014
//

If you have problems or comments...

PBIL Back to PBIL home page