(data stored in ACNUC7421 zone)

EMBL: CR954246.PE42

CR954246.PE42        Location/Qualifiers
FT   CDS_pept        complement(47082..47486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0046"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85156"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF12"
FT                   /protein_id="CAI85156.1"
FT                   /translation="MSCLPSAIKLSIVSIATSILLLSGCASTTSSSNDHGTSLASLNSQ
FT                   LNDIVSNNSCTASFQCKVLEVGARACGGPSKYTVYSTLNTQQEQAEQIAQQITAQENTL
FT                   NKAQGLTDCPSVLEVQSLCINQQCQPFEIK"
     atgagttgtt tgccatcagc aattaaacta tcaattgtaa gtattgctac tagtattttg        60
     ttactgagcg gctgtgctag cacaacatcg tcaagcaatg atcacggaac gagtttagcg       120
     agtcttaata gtcaacttaa cgatattgtt agtaacaata gctgtacagc tagctttcaa       180
     tgtaaagtgc ttgaagtagg tgcgcgtgcg tgcggtgggc caagtaagta tacggtgtac       240
     tcaacactta atacccaaca agaacaagct gagcagattg cacagcaaat aacagcacaa       300
     gaaaacacgc taaataaggc acaaggctta actgactgcc catcagtgct tgaagtacaa       360
     tcactgtgca ttaatcagca atgccaacct tttgaaataa aataa                       405
//

If you have problems or comments...

PBIL Back to PBIL home page