(data stored in ACNUC7421 zone)

EMBL: CR954246.PE420

CR954246.PE420       Location/Qualifiers
FT   CDS_pept        complement(452694..453614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0436"
FT                   /product="conserved protein of unknown function ; putative
FT                   GGDEF domain"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85534"
FT                   /db_xref="GOA:Q3IFS7"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFS7"
FT                   /protein_id="CAI85534.1"
FT                   /translation="MNFTLLKLHPRMIVLTLSIIVLALLLCNMMGTTKLWQEIDWWDVL
FT                   GEGGIVLLTILWQFFLLLSRPPGRVTTLLTVGLCCFMFSGLLDFLDEFFRYPQEAWLPL
FT                   IENIPAPFGMILISRGLYLWYQEMLVLNAQLRRREANVREHQNVDSVTWLYRADYMHEQ
FT                   LRLQLEQGGRYCVAVVDIDQFDTFNRRFGHPEGDRLLREIAELILMNARLTDLVCRYAG
FT                   DRFILLMPQLALPQASLQVQQIASAVKHLAFKSGDMAVFHTLTTAVIEATKGESCQALL
FT                   RRLNTQFAQQKSDKAGVAWCDHMSR"
     atgaatttta ctttgttaaa attacaccca cggatgattg tgttgacgct cagtattatt        60
     gtgcttgcgt tactgttatg taacatgatg ggtacgacca aactctggca agaaattgat       120
     tggtgggatg tactaggcga aggtggcatc gtattactga caatattgtg gcaatttttt       180
     ttattgctta gccgccctcc tgggcgagtt accacattat tgactgtagg actttgctgt       240
     tttatgtttt ctggtttatt ggattttttg gatgaatttt ttcgttatcc tcaagaggct       300
     tggttgcctt taatagagaa tattcccgct ccatttggca tgatcttgat tagtagaggc       360
     ttgtacttat ggtatcaaga aatgctagtg cttaatgctc aattacgtcg cagagaagcg       420
     aatgtgcgtg agcatcaaaa cgttgactct gttacttggt tatatcgtgc tgattatatg       480
     cacgagcaat tgcgtttaca acttgagcaa ggcggtcgct attgcgttgc tgtagttgat       540
     attgatcagt ttgatacctt taatcgtcgt tttggacacc ccgaaggaga ccggttacta       600
     agagagattg ctgagttaat cttaatgaat gcacgcctta ctgatttagt ttgtcgttat       660
     gcgggagatc gttttatttt actgatgccg caattagctt tgccgcaggc atctttgcaa       720
     gtacaacaaa tagcgagtgc agtgaagcac cttgccttta agtcagggga tatggcggtg       780
     tttcatacac taacaaccgc agtgattgaa gcgacaaaag gtgagtcatg tcaagccttg       840
     ctaaggcgct taaatacaca gtttgcacag caaaaaagtg acaaagcagg agttgcatgg       900
     tgcgaccata tgtcacgctg a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page