(data stored in ACNUC7421 zone)

EMBL: CR954246.PE421

CR954246.PE421       Location/Qualifiers
FT   CDS_pept        453923..456631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0437"
FT                   /product="putative tonB-dependent receptor"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type rc : receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85535"
FT                   /db_xref="GOA:Q3IFS6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR010104"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFS6"
FT                   /protein_id="CAI85535.1"
FT                   /translation="MKFKLSIISSACLAAMLSASAYAEPGNFVGTLSDGNKQVYFEGAQ
FT                   VKIKELNLTTQTRRDGTFRFNNIEPGHYTIEISYLGAAPIVKTIYIEENKTLKDQFTLT
FT                   ESGNTIEDIVVYGQRAGQAGALNMQRSADSIKSIVSSDAIGQFPDQNVAEALQRLPGLS
FT                   IERDQGEGRFVGIRGLDPNLNNVTVNGINIPSPEAGVRSVALDVFPSELVEGLEVSKSV
FT                   TSDMDADAIGGSVEIRSLSAFDRAGESASVTLQASHNQLRSDTSPKVSASYSNRYKFGN
FT                   VDDVFGVAAAVSWSDRDFGSDNIESNGDDEVEQRHYKINRERLGAALNLDYRPDFNNQY
FT                   YLRTLYSQFSDTEFRQANAFTFAGDDSEVERSSKDRFEEQQILSLTGGAEHQINQWLLT
FT                   YQAGYSKASEDEPEALNYVFKTDGFTLNSDLLGKIPHVEQQVGVSELANYKLDEIEFAN
FT                   NQSNDKEYSFRFDLAKDLTFLNYPSQIKFGSKYRSREKQQATQVTFFDGDFDNIDSDMF
FT                   VGGSPDWGLGEFGEGLNKHALRSFFNSNRANLEVAQLDSDIESRGESFINKEDILAAYI
FT                   MGTIDIEQLRIVAGFRYEKTQFSTSGHKVELIEDEYSDINQLDVNPWQVDRDYDYLLPS
FT                   LNVRYNVTENLISRFAYTQTLSRPKFEESAAFQIIESNTVKDSDGVLTTEREASVGNPE
FT                   LKPFESDNIDFTIEYYPGGIGVLSAGYFYKNISNFVIYADVANQPQWQGFDEVIQPING
FT                   DKATLQGIELAWVKTFENGLLLAANATFSDSEAVTLLDGKRFETSLPNQADRVGNLTVG
FT                   YEDEKWNLRLTMTHKSENLEEIDGELLRMEDSHQQLDFSSKYYINQKMNLYFNAINITD
FT                   QPFYNYFSERNRNAQYEEYGRTFELGFTWKM"
     atgaaattta aattatctat catctcttcg gcctgtttag ctgcgatgct tagtgcaagc        60
     gcttacgcag agccagggaa ttttgtaggt acgctaagcg acggtaacaa acaggtctac       120
     ttcgaaggtg ctcaagttaa aattaaagaa ttgaacctga ctacgcaaac tcggcgtgat       180
     ggtacttttc gctttaataa tatagagcca ggtcattaca ccatagaaat ttcttacttg       240
     ggggcagccc ccattgtaaa aacaatttat atcgaagaaa acaaaaccct taaagaccag       300
     tttacgttaa ctgaaagtgg caatactatc gaagacatcg tggtgtatgg ccaacgagcg       360
     ggtcaggctg gtgcgcttaa tatgcagcgc agtgccgata gtatcaaatc catcgtatca       420
     tccgatgcaa ttggtcaatt tccagatcaa aatgttgctg aagcgctaca acgccttcca       480
     ggtttgtcga ttgagcgtga tcaaggtgaa ggtcgctttg ttggcattcg cggtctagat       540
     cctaatctta ataatgttac ggtgaatgga attaatattc cttcacctga agccggtgtc       600
     cgatcggtgg cactggatgt gtttccttcg gagctagttg aaggcttaga agtatctaaa       660
     tcagtcactt cagatatgga cgcagacgct attggcggca gtgtagaaat tagaagctta       720
     agcgcctttg accgtgctgg agaatcggct agtgtgacac tgcaagctag ccataaccaa       780
     ctcagaagtg ataccagccc gaaagtgtct gcaagttata gtaatcgtta taaatttggt       840
     aatgtagatg atgtgtttgg tgttgccgct gctgtatctt ggtctgaccg tgactttggc       900
     tcagataaca tagaaagtaa tggcgatgat gaagtagagc aacggcacta caaaattaat       960
     cgtgaacgtt taggcgcagc cctcaacctt gattatcgtc ctgattttaa taatcagtac      1020
     tacctacgca cactttatag ccaattttca gatactgagt ttaggcaagc taatgcattt      1080
     accttcgctg gcgatgattc agaagttgaa cgtagctcta aagatcgttt tgaagagcaa      1140
     caaattttat cgcttaccgg cggtgcagaa catcaaataa atcagtggtt actcacctat      1200
     caagctggat attcaaaagc gtcagaagac gagcctgagg cgttaaatta tgtatttaaa      1260
     actgacggat ttacacttaa ctctgattta ctagggaaaa tccctcacgt cgagcagcaa      1320
     gtgggagtat ctgaacttgc caactataaa ctagacgaaa ttgaatttgc taacaatcaa      1380
     agtaacgata aggaatatag ctttcgattt gatttagcaa aagacttaac atttttaaat      1440
     tacccaagcc aaattaaatt tggtagcaag taccgcagcc gtgaaaagca acaagcaact      1500
     caagtaactt tctttgatgg cgactttgac aatattgact cggatatgtt tgttggcggc      1560
     tcaccagatt ggggattagg agaatttggt gagggcttaa acaagcatgc attacgtagc      1620
     tttttcaata gtaatcgtgc aaatttagaa gtagctcaat tagactctga tattgagtct      1680
     agaggtgagt catttattaa taaagaagat attttggccg cttatatcat gggtacaatt      1740
     gacatagagc agcttagaat tgtggcaggt ttccgctatg agaaaactca atttagtaca      1800
     tcgggccata aagttgaact aatagaagac gaatacagcg atattaatca gttagacgtt      1860
     aatccatggc aagtagatcg agattatgat tatttactgc caagcctaaa tgtgcgctat      1920
     aacgttactg aaaacttaat ttcgcgtttc gcctacacac agaccctctc tcgaccaaag      1980
     tttgaagaat cagcagcgtt tcaaattatc gaatcaaata ccgttaaaga tagtgatggc      2040
     gttttgacaa ctgaacgcga agccagtgtg gggaatccag aactaaaacc ttttgagtct      2100
     gacaacattg atttcaccat cgagtattac cctggcggca ttggtgtact ctcagcaggc      2160
     tatttttata aaaacatcag caatttcgtg atttacgctg atgttgcaaa tcaaccacaa      2220
     tggcaagggt ttgatgaagt tatacagccc atcaatggtg ataaggcgac cctacaagga      2280
     atagagctgg cttgggtgaa aacgtttgaa aatggtttat tgctcgctgc caatgcgact      2340
     ttttcagatt ccgaagctgt tactttactt gatggtaaac ggtttgaaac atcgttaccc      2400
     aatcaagcag atcgagttgg taacctgact gtaggttatg aggacgaaaa atggaactta      2460
     cgtttaacaa tgactcataa aagcgaaaat ctagaagaaa tcgatggtga gttattgcgt      2520
     atggaagata gtcaccaaca attagatttc tcgagtaaat attatattaa tcaaaaaatg      2580
     aatttatatt ttaacgctat caatatcaca gaccagcctt tttacaacta tttttctgag      2640
     cgtaatcgca atgcgcaata cgaagagtat ggccgtactt ttgaacttgg ttttacttgg      2700
     aaaatgtaa                                                              2709
//

If you have problems or comments...

PBIL Back to PBIL home page