(data stored in ACNUC7421 zone)

EMBL: CR954246.PE422

CR954246.PE422       Location/Qualifiers
FT   CDS_pept        456754..458682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0438"
FT                   /product="putative phytase domain protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0438"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85536"
FT                   /db_xref="GOA:Q3IFS5"
FT                   /db_xref="InterPro:IPR003431"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFS5"
FT                   /protein_id="CAI85536.1"
FT                   /translation="MKYSLVTTLLCSLLPIMGCHAQKTTTTTVNINPLFSEPAFSGKQG
FT                   VMLSGEEPKWLLTSESKGLLLLDQQAQPLSRFNGNFETLTMRENVLLNEEQSTLIATID
FT                   NEHNTIKLLSLKQDNTFTLQSSLPFEHSQLESLCLFRQPLGDISLFAVDAVGEVHQFII
FT                   YNAKQQHIDIQPIRSFVGVPEVQGCAVDDSREQLYLVEGNIGVWQYDANPESDPMRTLI
FT                   VAANPFGQLQGDISDISVTAEGSVWITTPENQQLHVIQPITGLYQSITLDGLTEPETVN
FT                   VTLHNKRFQAVVFDAVQDSYWQVDDLKNIVPQKLLKTTTLATISADVQTDPVLRFGDAA
FT                   DDPAIWVDQQTPANSLILGTDKRVGLMVYGLDGALLQSLEIGRVNNVDVRQHSSINSPL
FT                   NTIITASNRTKSSISVFELDEQRSVHHVGEIATDLGDIYGLCMYQSDSGSYVFVNDKDG
FT                   RYQQYRISATKPNIVAKKVREFALPSQPEGCSADDRTGKLYMGEEDAGIWQIDAEPNPS
FT                   AQASRIADVGDILKDDVEGMEVYHGQNASYLVVSSQGNNSFVVYGLWDDYPILTNFRID
FT                   MDLTNGIDGVSETDGLTVSAAALPGYPQGVLIVQDGRNQLPQQPQNFKVVDWRKVQALI
FT                   EQSDHVN"
     atgaaatact ccctagtcac cactttactg tgttcactgt tacctattat gggatgtcat        60
     gcacaaaaga caacgacaac aacagtcaac atcaatccac ttttttcgga gcctgcattt       120
     agtggtaaac aaggtgttat gttaagtggc gaagaaccca aatggctact cactagtgaa       180
     agcaagggct tgctattgct tgatcaacaa gcgcagccac ttagtcgctt taatggtaat       240
     tttgaaacgt taacgatgcg agaaaacgtg ctactcaatg aggagcaaag tactttaata       300
     gctactattg ataatgaaca caataccatt aagcttttga gccttaagca agataatact       360
     tttaccctgc aaagcagtct cccttttgag cacagccaac ttgaaagtct ctgtctattt       420
     cgtcaaccat taggtgatat ttcattattt gctgtggatg ctgtgggcga agtacatcaa       480
     tttataattt acaatgccaa gcaacagcac attgatattc agccaatacg tagctttgtt       540
     ggtgttcctg aagtacaagg ttgtgcggtt gatgatagcc gtgagcaact ttatttggtc       600
     gaagggaata tcggtgtttg gcagtatgat gctaatcctg agtcagatcc tatgcggaca       660
     cttattgttg cagcaaatcc atttggtcag ttgcaaggtg atatctctga tatttctgtt       720
     acagcagagg gatctgtgtg gatcactact ccagaaaatc aacaattgca tgtcattcag       780
     cctataacag gcttatatca atcaatcact cttgatggat taacagagcc agaaaccgtg       840
     aatgttactt tgcataacaa gcgcttccag gcagtggttt ttgatgccgt tcaagacagt       900
     tattggcaag tggatgattt aaaaaacatt gtccctcaaa agcttttaaa gacgactaca       960
     cttgccacta ttagtgcgga cgttcagacc gatcctgtgt tgcgttttgg agatgcagct      1020
     gatgatccag caatctgggt tgatcagcaa acccctgcaa atagtttaat tttaggcact      1080
     gataagcgag tcggattgat ggtatatgga ctcgatggtg cattattaca aagtcttgaa      1140
     atcgggagag ttaacaacgt tgatgtacgc caacactcaa gtatcaacag cccattaaat      1200
     accattatta ctgcaagtaa tagaaccaaa agtagtatta gtgtttttga gctagatgaa      1260
     caaagaagtg tgcatcacgt tggtgagata gccacagacc taggtgatat ttatggctta      1320
     tgtatgtatc aatctgactc aggtagctat gtgtttgtaa atgataaaga tgggcgttat      1380
     caacagtacc gtatcagtgc aactaaacct aacatagttg ctaagaaagt tagagagttt      1440
     gcgcttccta gccaacctga aggatgcagc gcagatgata gaacaggcaa gctttatatg      1500
     ggagaagagg atgctggaat ttggcaaata gatgctgaac ctaacccatc agcacaagca      1560
     agtcgtatcg ctgatgttgg tgatatttta aaagatgatg tagaaggaat ggaagtttat      1620
     catggtcaaa acgccagcta cttagtggta tctagtcaag gcaacaatag ttttgttgta      1680
     tatggtttat gggatgacta cccaatactt acgaactttc gtattgatat ggatttaaca      1740
     aatggtattg atggagtatc tgaaactgat ggactcaccg ttagcgctgc agccctgcct      1800
     ggttacccac aaggtgtact aatagtacaa gatggccgta atcaactacc gcaacaacct      1860
     caaaacttta aagtagtaga ttggcgtaaa gttcaagcac ttattgagca aagtgaccac      1920
     gttaattaa                                                              1929
//

If you have problems or comments...

PBIL Back to PBIL home page