(data stored in ACNUC7421 zone)

EMBL: CR954246.PE423

CR954246.PE423       Location/Qualifiers
FT   CDS_pept        458833..459633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0439"
FT                   /product="conserved protein of unknown function ; putative
FT                   hydrolase activity(metallophosphoesterase)"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0439"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85537"
FT                   /db_xref="GOA:Q3IFS4"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR042281"
FT                   /db_xref="InterPro:IPR042283"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFS4"
FT                   /protein_id="CAI85537.1"
FT                   /translation="MAGSSIRFAVLGDAEPKPVAEFPNLARAIDDVNRLASEKKIDFIL
FT                   GVGDIPHKGTMLQYNNVTPELQRLTLPFYPIMGNEEHGAEDAVTRFLHFANLWNKGKVT
FT                   IKSDKYTLEFDDFAIVLASPDHGRDFNSTGVNWILKQLKQLSPKPVLLVVHGAQQGVYP
FT                   ENPDKGISHEKFANVIAQPNLKAVISGDLHMDMDRVDHSKKIGKVHYLHIPALERTKIP
FT                   DETRHNPMYRVFNISPEGDVDVATYSVGNQHAIAEHSYQFSLNQ"
     atggcaggct ctagcatccg atttgcagtt ttaggtgatg cagaaccaaa acctgtcgca        60
     gagttcccta acttagctcg tgctatcgat gatgtaaatc gtctagccag cgaaaaaaaa       120
     atcgacttta tattaggtgt aggagacatt ccccataaag gcactatgtt gcaatataat       180
     aatgtaacgc cagaattaca acgtctgaca ttgccttttt accccattat ggggaatgaa       240
     gaacatggtg cagaggatgc tgtgacacgt tttttgcact tcgccaattt atggaataaa       300
     ggtaaagtaa cgatcaagtc tgataagtat actctagagt ttgatgactt tgctattgtt       360
     cttgcatcac cggatcacgg tcgtgatttt aatagtacag gggttaactg gatccttaaa       420
     caattaaagc aactcagccc aaaaccggtt ttacttgttg ttcatggtgc acaacaggga       480
     gtttaccctg agaatccaga taaaggtatt agccatgaaa aatttgctaa tgttattgcg       540
     cagcctaacc taaaagcggt gatctctggt gatttacata tggatatgga cagagttgat       600
     cactctaaaa aaattggaaa agtacactac ttacatattc cagcgttaga gcgtacaaaa       660
     attcctgatg aaacacgcca taaccctatg tatcgtgtat ttaatattag cccagaagga       720
     gacgttgatg ttgcaaccta ttctgttggt aaccaacatg ctattgctga gcatagttat       780
     cagtttagtt tgaatcagtg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page