(data stored in ACNUC7421 zone)

EMBL: CR954246.PE424

CR954246.PE424       Location/Qualifiers
FT   CDS_pept        complement(460427..460741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0441"
FT                   /product="putative orphan protein"
FT                   /function="6.2 : Hypothetical"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0441"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85538"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFS3"
FT                   /protein_id="CAI85538.1"
FT                   /translation="MPQIPLNSVLLGLFIRAPVLALFISHISNRGQNWPFFIIKLHKIR
FT                   SLIINHLALNNHQTRLKLGKQLKYKIKNKLSVATIKPRDIINFISAYQVSILALCVDAF
FT                   "
     atgccgcaaa taccgttaaa tagtgtgctt ttaggtttat ttattcgtgc gcctgtttta        60
     gcactcttta ttagtcacat ttcaaacagg ggacagaatt ggcccttttt tataattaag       120
     ttacataaaa tcagaagctt gattataaat caccttgctt taaataatca tcaaacacgg       180
     cttaaactag gtaagcaatt gaaatataaa ataaaaaaca aactaagcgt cgcaacaata       240
     aaaccccgtg atattatcaa ctttataagt gcctatcagg tgtcgatttt agcgctctgt       300
     gtggatgctt tttaa                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page