(data stored in ACNUC7421 zone)

EMBL: CR954246.PE425

CR954246.PE425       Location/Qualifiers
FT   CDS_pept        complement(460808..462103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0442"
FT                   /product="putative transport protein (MFS family)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85539"
FT                   /db_xref="GOA:Q3IEI7"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEI7"
FT                   /protein_id="CAI85539.1"
FT                   /translation="MAGVNIAIPNLAEDLNASAKMIAWMPTLYLLSSVMFMLPCGKIAD
FT                   NYGRKRVYASGLALNALASLMCALATSIEWVLFWRFIQGAAGAMIFGIGVAIITSVTPD
FT                   NKRGMALGTSAACVYIGLSAAPAMGGWLTEMWGWRAVFYSQIPLVLMLLITIKLFLQGE
FT                   WKNDKKSPFDWWGTVIFSLFALCLVLGLSDLPRMSGWLLTLLSITFLMLFIVHQSRSRR
FT                   PLIRVQMFLESRVFSLSLSTSFLMYASNFSLAFLLSLYLQYIKGLSPAHAGQIVLLQAV
FT                   SMAIMAPLAGKLADKIQPRLLATFGCIIVMIGFFLLSLLTVNSSTTYISGSLLLLGIGF
FT                   GLFSTPNNNAIMGAVDKSELGVASSSMNLSRTIGNLFGMSLINLIVQYYLGDSTFSAQN
FT                   SPALMSTISLAFKMSLGFVILASCISALRGRA"
     atggcaggcg ttaacatagc gatcccaaat ctcgctgaag atttaaatgc gagcgcgaaa        60
     atgatcgcgt ggatgcccac cttgtattta ctcagtagcg tcatgtttat gctaccgtgc       120
     ggaaaaatag cagacaacta tggccgcaaa cgcgtatatg cttctggttt agccttaaat       180
     gcgctggcct cgcttatgtg tgcgctggca acatcgattg agtgggtgct tttttggcgc       240
     tttatacaag gggccgctgg cgccatgatt tttggtatcg gcgttgccat cataacctct       300
     gtcacacctg ataataaacg agggatggca ctgggcacct ctgcggcatg tgtgtatata       360
     gggctcagtg ctgccccggc aatgggtggt tggcttactg aaatgtgggg atggcgcgcc       420
     gtgttttact cgcagatccc actggtactt atgctgctca ttaccattaa attgttttta       480
     cagggtgagt ggaaaaacga taaaaaatca ccgtttgact ggtggggcac cgttatcttc       540
     tcgcttttcg cactgtgctt agtattaggg ttaagtgatt taccacgtat gtcaggctgg       600
     cttttaacat tactttcaat cacctttttg atgttattta ttgttcatca aagtcgcagc       660
     cggcggccac tcattagggt acaaatgttt ttagaaagcc gtgtatttag cctctcactg       720
     tctacgtcat ttttaatgta tgccagtaac ttttcactgg cctttttgtt aagtttatac       780
     ttgcaatata ttaaaggctt aagccccgca catgctgggc aaatagtgtt actgcaagcg       840
     gtgtcaatgg ctatcatggc ccccctagct ggtaaacttg ccgataaaat acagccacgc       900
     ttactagcca cattcggctg tatcattgtt atgattggct tttttctact ttctctacta       960
     acggtgaact caagcacaac ttatattagc ggctcactgc tattattggg cattggcttt      1020
     ggcttatttt cgaccccaaa taacaatgcc attatgggcg cagtagataa aagcgagcta      1080
     ggtgtcgcat cttcttcaat gaatttgtca cgcacgattg gtaatttatt tggtatgagc      1140
     ttaatcaact taattgtgca gtattacctt ggagacagta ctttttcagc gcaaaatagc      1200
     cccgcattaa tgagcactat ttcattggcg tttaaaatgt ctttagggtt tgtgatcctc      1260
     gcaagctgta tttctgcact gcgtggtcga gcctaa                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page