(data stored in ACNUC7421 zone)

EMBL: CR954246.PE426

CR954246.PE426       Location/Qualifiers
FT   CDS_pept        complement(462542..463966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0443"
FT                   /product="putative RNAse with metallo-beta-lactamase-like
FT                   domain"
FT                   /function="3.2.2 : Processing and degradation of RNA"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0443"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85540"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEI6"
FT                   /protein_id="CAI85540.1"
FT                   /translation="MKILHHGAVNGVTGSCHELVINNSTSILIDCGLFQGEDSKTDLAI
FT                   GFDITNVTALIVTHCHIDHVGRIPYLLAAGFKGPIYTTKASASLLPLVIEDALKVGVTR
FT                   DPKIIAACLSLLAKRIVAVDFKTWFNLPINPSVNNAENTQTAKARFQRAGHILGSAYVE
FT                   IDIFENKSTKTTPNNTQGKSTHRVVFSGDLGAPYTPLLPTPKPPYKADTLVIESTYGDK
FT                   NHQGRKERTQTLKKVIEGAVADNGVVLVPAFSIGRTQELLYELEQLIHSAPKNSPWHSI
FT                   HVILDSPMAANFTEQYRNFKHLWDAEAKRKVAKGRHPLDFKNLTTIDTHKEHVAIISYL
FT                   ATRQTPAIILAASGMCTGGRIVNYLARFLSDKTTDILFVGYQGRGTLGHDIQTYGPRNG
FT                   YVFVNDTRIIINAKVHTISGYSAHADQNGLIKFVTGMRKKPNHIKIVHGDDDAKNALAN
FT                   KYREILGEKTFVEIAK"
     atgaaaatac tgcatcatgg ggctgttaat ggcgttaccg gttcgtgcca tgaactagtg        60
     ataaataaca gcacatcaat actcattgat tgtggactat ttcaggggga ggattcaaaa       120
     actgatttag ctattgggtt tgatataact aatgttacgg cattaattgt tactcattgc       180
     catattgatc atgtggggcg cataccgtat ttattggctg cgggatttaa agggcctatt       240
     tacaccacta aagcgtcggc cagtttatta ccactggtga tagaggatgc attaaaagta       300
     ggggtaacac gcgatcctaa aataattgct gcctgtttaa gcttgttagc caagcgtatt       360
     gttgcggttg attttaaaac ctggtttaac ttacctatca atccaagcgt taataatgct       420
     gaaaataccc aaacagccaa agcacggttt cagcgagccg ggcacatttt aggttcagcc       480
     tatgttgaaa ttgacatttt tgagaacaaa agcactaaaa ccactcctaa caacacacaa       540
     ggtaaaagta cgcatcgcgt ggtgttttct ggcgatctag gcgcgcccta tactccccta       600
     ttacccacac ctaagccgcc gtataaagcc gacaccttgg ttattgaatc gacctatggc       660
     gataaaaacc atcaagggcg taaagagcgt actcaaacat taaaaaaagt aatcgaaggt       720
     gcggttgccg ataacggcgt agtactcgtg cccgcgttta gtataggtcg aactcaagag       780
     ctactttacg aactagagca gttaattcac agcgcaccta aaaactcacc atggcacagc       840
     atacacgtaa tactagactc ccccatggcg gcaaatttta ctgagcagta cagaaatttt       900
     aaacatttat gggacgctga agccaaacgc aaagttgcca aaggccgcca cccgctcgac       960
     tttaaaaacc taaccacaat cgacactcat aaagagcatg tggccattat tagctactta      1020
     gccactcgcc aaacccccgc cattatttta gccgccagcg gcatgtgcac cggcgggcgc      1080
     attgtaaatt acctagcgcg ttttttaagt gacaaaacca ccgacatact gtttgtaggc      1140
     tatcaaggac gcggcacatt agggcatgat atacaaacct atggccctcg taacggctat      1200
     gtatttgtaa acgacactcg cattatcata aacgccaaag tacacactat aagcggctac      1260
     agcgcccacg cagatcaaaa tgggttaata aaatttgtaa ccggcatgcg taaaaagccc      1320
     aaccatataa aaatagtgca tggcgatgat gatgcgaaaa atgcgctcgc aaataaatat      1380
     cgcgaaattt taggagaaaa aacattcgtg gaaatcgcta aataa                      1425
//

If you have problems or comments...

PBIL Back to PBIL home page