(data stored in ACNUC7421 zone)

EMBL: CR954246.PE429

CR954246.PE429       Location/Qualifiers
FT   CDS_pept        466693..467199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0446"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0446"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85543"
FT                   /db_xref="GOA:Q3IEI3"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEI3"
FT                   /protein_id="CAI85543.1"
FT                   /translation="MQLSRKGWNNVIIFSMLIMIFFLNGWHKDIGGSNNEPVLQPVLPI
FT                   QSFVLTLSFVDQKIERIGTSWRTTALQTDVPLTWQGTEQQLGELVNVWQSAQLMSVHES
FT                   VVFNPNAPLSVATFELAGEPLPWVYLLYKGDGQYYLLEKNSQRVFALDLAVVKQLFPSS
FT                   TPSEQ"
     atgcaattaa gccgtaaagg ttggaacaac gttattattt tttcgatgtt gattatgatc        60
     ttctttttaa atggttggca caaagatatt ggtggtagta ataacgagcc ggtactgcaa       120
     ccagtgttac caatacaaag ttttgtatta acgttgagtt ttgttgatca aaaaattgaa       180
     cgtataggca caagctggcg tacaaccgca ttacaaactg atgtgccgct tacttggcaa       240
     ggcacggagc agcagttagg cgaactggtt aacgtgtggc aaagtgctca gcttatgtcg       300
     gttcatgagt cagttgtttt taatcctaat gcgcccctct cggtagctac ctttgaactg       360
     gcgggcgaac cattaccttg ggtgtatttg ctttacaagg gcgatggtca gtattatcta       420
     ctcgaaaaaa atagccagcg tgtatttgcg cttgatttag ctgtagttaa acagttgttt       480
     cctagctcaa ccccgagtga acaataa                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page