(data stored in ACNUC7421 zone)

EMBL: CR954246.PE43

CR954246.PE43        Location/Qualifiers
FT   CDS_pept        complement(47497..48018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0047"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85157"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF11"
FT                   /protein_id="CAI85157.1"
FT                   /translation="MRTPLLAIFLPLCLTACLDNPVAETEKTTASEATTPSQQKLQQLQ
FT                   KSNKAELHAPAEKLSNTAMKTVTLDDIKTAKNELNTLIANKQCDSSTQCQVEAVGSRAC
FT                   GGPSSYIVYSTTTATTEQVTALSKKITTFESNYNAQNQMVSICQHLTAPSTQCVENKCV
FT                   KLEGSAVSVF"
     atgcgtacac cattgctagc tatattttta ccactgtgtt taaccgcttg tttagataac        60
     cccgtagcag aaacagaaaa aacaactgcc agcgaagcaa caacgccatc gcagcaaaaa       120
     ctacaacaac tgcaaaaaag taacaaagca gaattacatg ccccagccga aaaactatca       180
     aatactgcca tgaaaacagt tactcttgat gacattaaaa cagctaaaaa tgaattaaat       240
     acgctcattg ctaataaaca atgtgatagc agtacgcagt gccaagtaga agctgtaggt       300
     agccgagcat gtggcggccc aagtagttat atagtgtatt caacgacaac agcaacaact       360
     gagcaagtca ctgcattaag taaaaaaatc actacttttg aaagtaacta taatgcccaa       420
     aatcaaatgg tcagtatttg ccaacattta actgcgccaa gcacgcagtg tgtagaaaat       480
     aaatgtgtta aacttgaagg ctcagcagta agtgtatttt aa                          522
//

If you have problems or comments...

PBIL Back to PBIL home page