(data stored in ACNUC7421 zone)

EMBL: CR954246.PE431

CR954246.PE431       Location/Qualifiers
FT   CDS_pept        468181..468531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0448"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85545"
FT                   /db_xref="InterPro:IPR012657"
FT                   /db_xref="InterPro:IPR036583"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEI1"
FT                   /protein_id="CAI85545.1"
FT                   /translation="MMNFENLDVWKRSTRLSADIYKNPTLKKDFGFRDQLTRSGLSVPS
FT                   NIAEGMTRDSDKEKVRFLDIARSSLAEARTQIYIAIDINYIESDVGRAWLNETFELSKM
FT                   LTSLISKIKTRI"
     atgatgaatt ttgaaaactt agatgtttgg aaacgctcta cccgtttaag tgcagatatt        60
     tataaaaacc caacattgaa aaaagacttt ggctttaggg atcaattaac gcgatcaggc       120
     ttatctgtcc ctagtaatat agcagaagga atgacgcgag atagtgataa agaaaaagtt       180
     cgctttttag atattgcgcg ttcttcgtta gctgaagctc gaacacaaat ttatattgcc       240
     atagatataa attatataga atcggatgtt ggtcgggctt ggttaaacga aacctttgag       300
     ttatcaaaaa tgctgacaag cttgatatct aaaattaaaa ctcgaatttg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page