(data stored in ACNUC7421 zone)

EMBL: CR954246.PE432

CR954246.PE432       Location/Qualifiers
FT   CDS_pept        complement(468736..469236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0449"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0449"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85546"
FT                   /db_xref="InterPro:IPR021727"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEI0"
FT                   /protein_id="CAI85546.1"
FT                   /translation="MTFLKTTFQYIALVSLILTSFVSSANPPKEIFWEDLIPQGHMQIN
FT                   TQAQANHEGSEQNWVQPDLNAPVVKALDGKSVSLPGFVVPLEGDSEVITEFLLVPYFGA
FT                   CIHVPPPPPNQIVHVTIKGGVPIDSLYDAIVVTGVISTQTWSGEIAQVGYTMKAVGVAP
FT                   FEL"
     atgacgtttt taaaaacaac ttttcaatac atcgccttgg taagcttaat actaaccagc        60
     tttgttagta gtgcaaatcc acccaaagaa attttttggg aagacctaat tccacaaggt       120
     catatgcaaa taaacaccca agcgcaagct aaccacgaag gcagtgaaca aaactgggtt       180
     caaccagatc taaacgcacc tgtagtaaaa gcacttgatg gtaaatcggt aagcctaccg       240
     ggttttgtag taccacttga aggcgacagt gaagtaatta ccgaattttt actggttcct       300
     tattttggcg cctgtataca cgtaccgccg ccgccgccaa atcaaatagt acatgtaacc       360
     attaaaggcg gagtccccat cgacagccta tacgacgcca tagtagtgac tggtgtaatt       420
     agcacccaaa catggtctgg cgaaatagcc caagtaggct acacaatgaa agccgtaggc       480
     gtagccccgt ttgagcttta a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page