(data stored in ACNUC7421 zone)

EMBL: CR954246.PE433

CR954246.PE433       Location/Qualifiers
FT   CDS_pept        complement(469248..470480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0450"
FT                   /product="conserved protein of unknown function ; putative
FT                   transmembrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85547"
FT                   /db_xref="GOA:Q3IEH9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEH9"
FT                   /protein_id="CAI85547.1"
FT                   /translation="MILIKLAYKSLLNRRSSVLLTLLTIAISVMLLLSIERVRIDAKSS
FT                   FSNTISGTDLIVGARTGDIQLLLSSVFRIGHTNNGVSWQSYEYITGQRGVKWSIPISLG
FT                   DSHKGQAVLGTTLDYFNYYRFGKKQPLSFKQGHAFNTINQVVLGSGVASKLNYKLGDSI
FT                   VISHGMGSTSFHHHDDNPFKVVGILNATGTPVDKTLHIPLAAIDLIHGGHSEEHDEHSN
FT                   LVGHPKQITAFLMGFNSPLYTLQIRRNINQYKKEALLGIMPTVTLKELWEMLAIVEKIL
FT                   LLFSVVVVIISLLGMLTTLLANLNQRRRELAILRSVGARPWQLFTLISIESLLTTLLGC
FT                   IVGCVLFYALMFFGAGYLQSHAGISINIAMLSYYELTLIGVIMIAGFIIGLIPATRAYF
FT                   YSLSDGMSIKI"
     atgatcttaa ttaaactcgc ctataaaagc ctattaaacc gtcgtagcag cgtgctgtta        60
     accttactta ccatcgccat tagcgtcatg ttactgctaa gcattgaacg ggtacgcata       120
     gacgcaaaaa gtagttttag taatactatt tcgggcaccg atttaattgt cggtgcgcgc       180
     actggcgata ttcaattgct gctctcgtcc gtatttagaa taggccacac taacaatggt       240
     gtgagttggc aaagttatga atacataacc ggacaacgcg gcgtaaagtg gagcattcca       300
     ataagccttg gcgacagcca caaaggccaa gcagtattag gtaccaccct tgattacttt       360
     aattattatc ggtttggcaa aaagcagcca ctgagcttta agcaaggcca cgcatttaac       420
     acgattaacc aagtcgtgct ggggagtggg gtagcgagta aattaaacta taaactgggc       480
     gacagcattg ttatatctca tggtatgggc agcactagct ttcatcatca tgatgacaac       540
     ccgttcaaag tggtcggtat tttaaatgcc accggcaccc ctgtagataa aacgctgcat       600
     ataccgctgg ccgctatcga tttaatccat ggtggccata gtgaagagca tgatgaacat       660
     agcaacttag ttggccaccc aaaacaaatt actgcgtttt taatgggctt taactctcca       720
     ctttacacgc tgcaaattag gcgcaatata aaccaatata aaaaagaagc actgctgggt       780
     attatgccca cagtaacact aaaagagtta tgggaaatgc tcgctattgt tgaaaaaata       840
     ctgctgctat tttctgttgt ggtagtcatt attagcttgc ttggcatgtt aaccacgctc       900
     ctagctaatc ttaatcagcg ccgcagagag cttgccatat tacgctcagt aggcgctcgg       960
     ccatggcagc tatttactct cattagcata gagtcactgc ttaccacttt actcggctgc      1020
     attgttgggt gtgtattatt ttatgcgctg atgttttttg gcgcaggtta cttacaaagt      1080
     cacgctggta ttagcattaa tattgccatg ctctcttact atgaactcac acttataggc      1140
     gttattatga ttgcaggatt tattattggt ttaattcccg ctactcgcgc ttacttttac      1200
     tcactcagcg atggcatgag tataaaaata taa                                   1233
//

If you have problems or comments...

PBIL Back to PBIL home page