(data stored in ACNUC7421 zone)

EMBL: CR954246.PE434

CR954246.PE434       Location/Qualifiers
FT   CDS_pept        complement(470477..471163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0451"
FT                   /product="putative ABC transporter"
FT                   /function="1.2 : Transport/binding proteins and
FT                   lipoproteins"
FT                   /EC_number="3.6.3.30"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85548"
FT                   /db_xref="GOA:Q3IEH8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEH8"
FT                   /protein_id="CAI85548.1"
FT                   /translation="MITISKLLFKWHKNAVSPTLNINQLNIKQGEHVFLHGPSGCGKST
FT                   LLALLAGINTATSGEVSILNKNLNSLSNTQRDVFRADHIGYIFQNFNLLPYLTPLENVS
FT                   LGCQFSKQRQQRALQQSNCLTAESARLLNALGLAQHLHHQDVGKLSIGQQQRVAAARAF
FT                   IGSPELIIADEPTSALDTNNRQSFIKLLFEQAKHANSTLVFVSHDESLQPLFNRSIDLV
FT                   NLQAAS"
     atgatcacaa tttctaagct gttatttaaa tggcataaaa atgcagttag ccccacactt        60
     aatattaacc agctgaacat taagcaaggc gagcatgtgt ttttacatgg accaagtggc       120
     tgtggtaagt cgaccttact ggcactatta gcgggtatta ataccgccac cagcggtgaa       180
     gtaagtattt taaataaaaa cttaaacagc ctaagtaata ctcagcgcga tgtatttaga       240
     gcggatcata ttggttatat ttttcaaaat tttaatttgc tcccctattt aacgccgctg       300
     gaaaacgtaa gcttgggttg ccagttttca aagcagcgcc aacaacgggc gctacagcaa       360
     tcaaactgct taaccgcaga gtccgcaaga ttgcttaatg ccttagggtt agcgcaacat       420
     ttacatcatc aagatgtggg taagttaagc attggccagc aacaacgtgt ggctgccgcg       480
     cgtgcattta ttggcagccc agaattaatt attgccgacg agcccacatc ggcgctcgac       540
     accaacaacc gccaaagctt tataaaactg ctgtttgagc aagctaagca cgccaacagt       600
     actttagtat ttgttagcca cgacgaaagt ttgcaaccac tttttaatcg cagcatcgat       660
     ttagttaatt tgcaggcagc atcatga                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page