(data stored in ACNUC7421 zone)

EMBL: CR954246.PE435

CR954246.PE435       Location/Qualifiers
FT   CDS_pept        471494..471814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0452"
FT                   /product="conserved protein of unknown function; putative
FT                   transcriptional regulator (hipB)"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85549"
FT                   /db_xref="GOA:Q3IEH7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEH7"
FT                   /protein_id="CAI85549.1"
FT                   /translation="MSNCVFRATVINYLLLSEGDVQLAFAAHLQALRKKAKLSREALAK
FT                   KSTVPASTIKKFEVTGLISFRQLLLLWQSLDDLTRLYDLTKDLPQSKDAPTSIEQVLKN
FT                   GL"
     gtgtctaatt gtgtttttag ggctacagtt atcaattatt tattattaag tgaaggcgat        60
     gtgcaacttg cttttgcagc acatttacaa gcgcttcgaa aaaaagctaa attgtctcga       120
     gaagctttag ctaagaaaag taccgtaccg gcttctacaa taaaaaaatt tgaagttacg       180
     ggactcattt catttaggca gctattactt ttgtggcaat cattagacga cttaactcgt       240
     ttatatgatt taacaaaaga tcttcctcaa agtaaagatg caccaacgtc tatagagcag       300
     gttttgaaaa atggtcttta a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page