(data stored in ACNUC7421 zone)

EMBL: CR954246.PE436

CR954246.PE436       Location/Qualifiers
FT   CDS_pept        471804..473099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0453"
FT                   /product="conserved protein of unknown function ;putative
FT                   hipA protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 1715862, 8021189; Product
FT                   type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0453"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85550"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFR5"
FT                   /protein_id="CAI85550.1"
FT                   /translation="MVFKPINKLEVKRTLSDSTELLVGVLAQNRQGVYFQFDQNYLDQY
FT                   SNLSPFSLSFNRDVQLAPKSPHNGLHGVFSDCLPDGWGSLLQDRVFRQNNIMPNFVTAM
FT                   DRLSFVGHSAMGALSFTPEANYNIPSEEEPGLAELGQQAQAIFDGQTETVLSALVAAGS
FT                   SGGARPKAQVYFPEHNIEECRTQPKIGDDAWLIKFTSKNLSLGHEEGLCEAVYLELADK
FT                   AKLSPPERLLVNAPEGTGAKQWLALKRFDRFKLPSNKMGRKQMHSACGLLDADFRAPTL
FT                   DYEDLIKASRVLCKSPAAGQLQFRRAIFNLFSCNQDDHSKNWAFLQEDSGEWNLAPFYD
FT                   VTFSPHPFNEHATSFAGYGKNPPIKAIQKLASAAGYANWKQVQIIISEIADIVFSFKDT
FT                   AKTFEVNKQTIQLIEQQLDNTYRINKQLCGSL"
     atggtcttta aaccaataaa taaactagaa gttaaacgta cgctatctga ttccacagaa        60
     ttacttgttg gtgtgcttgc tcaaaatcgg cagggtgttt attttcaatt tgatcaaaac       120
     tacttagatc aatatagcaa cctttcacca ttttcattgt cctttaatag ggatgtgcaa       180
     ttagcaccta aaagcccaca caatgggctt catggagttt tttctgattg tttgcctgat       240
     ggttggggat cattacttca ggaccgtgtt tttagacaaa ataatataat gccaaacttc       300
     gttactgcaa tggaccgatt atcgtttgtt ggccattctg ctatgggggc attatctttt       360
     acaccagagg ctaattataa tattccaagt gaagaggagc caggtctagc tgaattaggc       420
     caacaagctc aagccatttt tgatgggcaa acagaaacag tactttcggc attggttgca       480
     gctggtagct ctggtggtgc acgtcctaaa gctcaagtat attttcctga acataatata       540
     gaagaatgta gaactcagcc taaaattggt gatgatgcat ggctgataaa atttacatcc       600
     aaaaatttgt ctttaggcca tgaagaagga ttgtgcgaag ctgtgtattt ggagttagca       660
     gataaagcta aattaagccc acctgaaaga cttttggtaa atgcacctga aggcactgga       720
     gcaaaacaat ggctggcatt aaagcgattt gatagattta aattaccaag caataaaatg       780
     ggccgtaaac agatgcacag cgcatgtggt ttattggatg ctgactttcg tgcacccaca       840
     ttagattatg aagatttaat taaagctagt cgtgttttat gcaagtctcc tgctgctggg       900
     cagttacagt ttcgccgagc tatattcaat ttgtttagtt gtaatcaaga tgatcattca       960
     aaaaactggg catttcttca agaagactct ggcgagtgga acctagctcc tttttacgat      1020
     gttactttta gtcctcatcc gtttaatgag catgcaactt cgtttgcagg atatgggaaa      1080
     aaccctccaa taaaagcaat tcaaaagtta gcctctgcgg ctgggtatgc aaattggaaa      1140
     caagttcaga ttataatctc tgaaattgca gacattgttt ttagctttaa agacacagct      1200
     aaaacatttg aggtaaataa acagactatt caattgattg aacaacaact tgataatact      1260
     taccgcataa ataaacagtt atgcgggagt ctttaa                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page