(data stored in ACNUC7421 zone)

EMBL: CR954246.PE438

CR954246.PE438       Location/Qualifiers
FT   CDS_pept        474474..475151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0455"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85552"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR034242"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFR3"
FT                   /protein_id="CAI85552.1"
FT                   /translation="MFERALQVFAKKRYLFALSVLFSHAAISANIDLVIKDQHGMVLPN
FT                   AVVEIGQANTAFKPTNPSVKKLPVAVMDQVNKQFLPELLIVQQGQLINFPNSDNIRHNV
FT                   YSFSSAKSFQLKLYSGQPKEPIIFDTQGVVVLGCNIHDSMVGYIYVAKSEQVYKTDKNG
FT                   VVSLPVTTQPLQISVWHALQTAPLENKKMMNIEPQAILPITINTSSPAPRNTFGSQFKG
FT                   GND"
     atgtttgaac gagcattgca agtttttgca aaaaaacgtt atttattcgc tttaagtgtg        60
     ctttttagcc acgctgctat tagcgcaaat attgatttag taataaaaga tcaacacggt       120
     atggtgttac ctaatgccgt tgttgaaata ggccaagcaa acactgcttt taagcctaca       180
     aatccaagtg ttaaaaagct ccccgttgcg gtaatggatc aggtaaataa gcagttttta       240
     cctgagctac ttattgtgca gcaagggcaa ttaattaact ttcctaatag cgataatatt       300
     cgccataacg tgtattcgtt ttcaagcgct aaatcttttc aattaaaact ctactcaggg       360
     caacccaaag agccaattat ttttgacact caaggtgttg tggtactagg ctgtaatatt       420
     catgattcta tggtgggtta tatctatgtg gctaagagtg agcaagttta taaaaccgat       480
     aaaaacggag ttgtaagttt acctgttact acgcagcctt tgcaaataag tgtgtggcat       540
     gcgttgcaaa ctgcgccttt agaaaataaa aaaatgatga atatagagcc acaagctatt       600
     ttacctataa ccataaatac ttcctcgcca gcaccacgta acacctttgg cagtcagttt       660
     aagggcggta atgactaa                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page