(data stored in ACNUC7421 zone)

EMBL: CR954246.PE439

CR954246.PE439       Location/Qualifiers
FT   CDS_pept        475144..477459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0456"
FT                   /product="putative HAMP domain/GGDEF domain/EAL domain
FT                   protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85553"
FT                   /db_xref="GOA:Q3IFR2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029150"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFR2"
FT                   /protein_id="CAI85553.1"
FT                   /translation="MTNNLRNRITILCVGLVLLTTVVSLLSFWWSTSKFQEEKVNQDIS
FT                   VAQNVYKQYLNSKENLLLTAAKVLTSDFGFKQAVATRDAATISSVLYNHSQRINADLML
FT                   LLDLSGQLISTNDDEDNFTDNLQPLMSELLTTAERSSFVVLNGQLYQVILLPVKTPRTI
FT                   AYSLVGFKITSDVASELKSLTGMEVSFIASADSLVKTSLVAPPANLQPVNYFNSKTTSR
FT                   FFGDYLVYKNREIELPALQAHPVIILLSADLTQSYRDFEQLFITLIILAILTLIVGVVT
FT                   SSLLANNLTTPLSQLAVVAKQFAKGNYNFEFKGSKQSCEITTLMDAFHHMGSDINKREQ
FT                   QISYQARHDTLTGFYNRSAMLEMLAKQLNKSTEHTLVAIDIKGLRHINDKLGPRIGDDC
FT                   LKAVAKRISEFSDELGGFHARIGGDEFLTVFPAGAVSEFKRGIIALMAQLQASYTIQNL
FT                   KINLRFSVGVVQYPLHGEQAEDLIRRVLIAVDSATSHHQNIHYYQQGEDEAHLERLVML
FT                   DELKQAISDDDGQLFMTYQPKLNMKIQKVDKVESLIRWQRKDGSWVSPEVFIDLAEQSG
FT                   LIVELTAWVVNTVIAQVAAWQQKGIHLQAAINVSAQDIAFAGFHSSLVRTLKKHKVNPA
FT                   LITIELTERDMIENEEKGIIALENLKAIGVKISLDDYGVGQTSLGRLKMLPIDELKLDK
FT                   CFILKLDESQKDQFIVQSSITLGHQLGFSVVAEGVETVGTLTLLKQMQCDHAQGYYLSR
FT                   PLKAELLEQWLEEYDGVH"
     atgactaaca atttgcgaaa ccgtataacc attttatgtg taggcttggt gttattaacc        60
     actgtggtta gtttgctgag cttttggtgg tctacaagta agtttcaaga agaaaaagtc       120
     aatcaagaca taagcgtggc acaaaatgtt tataaacaat atttaaactc gaaagaaaac       180
     ctactattaa ctgccgctaa agtactcacc tccgattttg gctttaaaca agcggttgcc       240
     acgcgtgacg ctgctactat aagcagtgtt ttatacaatc atagccagcg tataaatgcc       300
     gatttaatgc tgctgttaga tttgtcgggg cagttaatat caaccaatga tgatgaggac       360
     aactttaccg ataatctgca gcctttaatg agtgagttat taactaccgc ggagcgctct       420
     agttttgtgg tattaaatgg ccagctttat caggttattt tactgccagt taaaaccccg       480
     cgcaccatag cttacagttt agtgggtttt aaaataacca gtgatgtagc ttcagagctt       540
     aaaagcctaa caggtatgga agtaagcttt atagcgagcg cagatagctt agtaaaaacc       600
     tcattggtag cccctccagc aaacttgcaa ccagttaatt attttaatag caaaacgacg       660
     tcgcgctttt ttggtgatta tttagtgtat aaaaatcgtg aaattgagct gcctgcactg       720
     caagcgcacc cggtaataat tttactcagt gccgatttaa cccaaagcta tcgcgatttt       780
     gaacagctat ttattacgct gattatactt gccatactta ctttaattgt tggggtagta       840
     accagtagtt tattagcaaa taatttaact acaccactgt cgcaattggc cgtggtggct       900
     aagcaatttg caaagggtaa ttataatttt gaatttaaag gcagcaaaca aagctgtgaa       960
     ataactaccc ttatggatgc ttttcatcac atggggagtg atataaataa gcgtgaacag      1020
     caaattagct atcaggctcg ccatgatacg ctaactggct tttataaccg ctcggctatg      1080
     ctagaaatgc tagccaaaca attaaataaa agcacagaac acacgctagt tgctatcgat      1140
     attaaaggct tgcggcatat aaacgataag ttagggccac gtattggcga tgattgttta      1200
     aaggcggtgg caaagcgtat tagtgaattc tcagatgagt tgggtggctt tcatgcgcgt      1260
     attggtggcg atgagttttt aaccgtgttt ccggcggggg cagtgagcga atttaaacgc      1320
     ggtattattg ctttaatggc gcagctccaa gcaagttaca ccattcaaaa cttaaaaata      1380
     aacttacgct ttagtgtggg ggtggtgcaa tatccgctac acggtgaaca agctgaggat      1440
     ctaattcgcc gagtacttat agcggtagat agcgcaacta gtcatcatca aaatattcat      1500
     tactatcaac aaggcgaaga cgaagcgcat ttagagcgct tagttatgct tgatgaactt      1560
     aagcaagcta taagcgatga tgacggccag ttatttatga cctatcagcc aaaactaaat      1620
     atgaaaatac aaaaggttga taaggtagag tctttaattc gctggcagcg taaagatggt      1680
     agttgggtgt cgcctgaggt gtttattgat ttagccgaac agtcgggatt aattgttgag      1740
     ctcactgcct gggtggttaa taccgttatt gcacaagttg ccgcttggca gcaaaaaggc      1800
     atacatttac aagcggctat caatgtatcg gcacaagata ttgcgtttgc ggggtttcat      1860
     tcgtcattag tacgtacttt aaaaaagcat aaggttaacc ctgcgttgat caccattgag      1920
     ctcaccgagc gcgatatgat cgaaaatgaa gaaaaaggca taattgccct cgaaaactta      1980
     aaagccattg gggtaaaaat atcgcttgat gattatggcg tagggcaaac atcgttagga      2040
     cgtttaaaaa tgctaccaat tgatgagctt aaattagata agtgctttat tttaaaacta      2100
     gatgaatcgc aaaaagatca atttattgtg cagtcgagta ttactttagg gcatcaatta      2160
     gggttttcgg tagttgccga aggagtagaa actgtaggaa ccttaacatt acttaagcag      2220
     atgcaatgcg atcacgcaca aggttattat ttaagtcgac cattaaaagc tgagctatta      2280
     gagcagtggt tagaggaata cgatggcgta cattaa                                2316
//

If you have problems or comments...

PBIL Back to PBIL home page