(data stored in ACNUC7421 zone)

EMBL: CR954246.PE440

CR954246.PE440       Location/Qualifiers
FT   CDS_pept        477446..478279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0457"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0457"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85554"
FT                   /db_xref="InterPro:IPR021393"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFR1"
FT                   /protein_id="CAI85554.1"
FT                   /translation="MAYIKCFMAGVLLTASFIAAASSGKLLATPGVSQVEGAGGGGLVP
FT                   WAQLAGYASEDEVSVNGFCSRADVTDYTLDVCGAQLNLFNRVELSYAQQEFDVPALSTQ
FT                   IEQSITGAKVRLYGDIVYSSWPQVSLGMQHKSLDDGTVAKLVGAQSTSGTDFYLAASKL
FT                   HLGAIAGYNWFWNVTTRYSKANQLGLLGYGGNNASNKLLFEASTAIFLSREVALGVEYR
FT                   QKTNNLGLGEQDWKDVFVAWMPNKHMSVTAAYLDLGSIAGASDQTGWYLSVTGYW"
     atggcgtaca ttaagtgttt tatggcgggg gtattactca cagccagttt tattgctgct        60
     gcgagtagcg gtaaattatt agctactcct ggggtgtctc aagttgaggg cgctggtgga       120
     ggtggccttg ttccgtgggc gcaacttgct gggtatgcca gtgaggatga ggtttcggtt       180
     aatggttttt gtagccgtgc agatgtaacc gactatacgt tagatgtatg tggcgcacag       240
     cttaatttgt ttaatcgcgt tgagcttagc tatgcgcagc aagagtttga tgtacccgcg       300
     ctgagtacgc aaatagagca gtcgataact ggtgctaaag ttcgtttata tggcgacatt       360
     gtttacagta gttggccaca agtaagttta ggtatgcagc ataagtcgtt agacgatggc       420
     acggttgcaa agctagtggg tgcacagagc accagcggca ccgactttta cttagcggca       480
     agcaagttac acttaggtgc tattgcagga tacaactggt tttggaacgt gaccacccgt       540
     tacagcaaag ccaaccaact agggttactg ggttatggcg gcaataatgc cagcaataaa       600
     ttgttatttg aggcaagcac agcgatattt ttaagccgtg aagtagcgtt aggtgttgag       660
     tatcgtcaaa aaacaaataa cctaggatta ggcgagcaag attggaaaga tgtgtttgta       720
     gcttggatgc caaataaaca tatgagcgta accgccgcct acttagattt aggcagtata       780
     gctggagcaa gcgatcaaac cggttggtat ttatcggtga caggatattg gtaa             834
//

If you have problems or comments...

PBIL Back to PBIL home page