(data stored in ACNUC7421 zone)

EMBL: CR954246.PE441

CR954246.PE441       Location/Qualifiers
FT   CDS_pept        478279..478698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0458"
FT                   /product="putative protozoan/cyanobacterial globin family
FT                   protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85555"
FT                   /db_xref="GOA:Q3IFR0"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFR0"
FT                   /protein_id="CAI85555.1"
FT                   /translation="MRVFILFLLATSVLAGCSSKPKQSLYQQINGNAGIEKLVDSFIYQ
FT                   IGNDRQVFHYFEHSNITHFRQGFISHLCALTNGPCEYKGDSMVAIHTGMNINEKDFNHV
FT                   VDLLINAMDEQSIPHPVQNKIISKMAPLRSEIIKI"
     atgagagttt ttatactatt tttattggct acaagtgtat tagctggctg tagcagcaag        60
     cctaaacaga gtttgtatca gcaaataaat ggtaatgccg gcatagaaaa actagtggat       120
     agctttattt atcaaatagg taatgacagg caagtgtttc actattttga gcacagtaac       180
     attactcatt ttcgccaagg ctttataagc cacttatgcg cgctaacaaa cggcccgtgt       240
     gagtataaag gcgactctat ggttgctatt cataccggca tgaatattaa tgaaaaagat       300
     tttaatcatg tagtcgatct gctaattaat gctatggacg agcaaagtat accccatccg       360
     gtacaaaata aaataatatc gaaaatggca ccactgcgca gtgaaataat aaagatttaa       420
//

If you have problems or comments...

PBIL Back to PBIL home page