(data stored in ACNUC7421 zone)

EMBL: CR954246.PE443

CR954246.PE443       Location/Qualifiers
FT   CDS_pept        complement(479597..479947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0460"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0460"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85557"
FT                   /db_xref="InterPro:IPR040807"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFQ8"
FT                   /protein_id="CAI85557.1"
FT                   /translation="MTQINCTQCNAALTCNVTDISACWCNELPAILPLDLNATSCLCRN
FT                   CTLAKINTYLQSLYSQPIKIQLAFAKQFKNNGELIEGLDYTMQNSYMVFSKWYFLKRGT
FT                   CCKNGCKNCPYS"
     atgacccaaa ttaactgcac ccaatgtaat gctgctctta cctgtaatgt gactgacata        60
     tcagcatgtt ggtgcaacga gttacccgct attttaccgt tagatcttaa cgctacaagc       120
     tgtttatgcc gtaactgtac gctggctaaa ataaacactt acttacaaag cctttactcg       180
     cagccgatta aaatacaact cgcgtttgct aagcaattta aaaataatgg agagctgatt       240
     gaagggctcg attacactat gcaaaacagc tatatggtat ttagtaagtg gtatttttta       300
     aagcgtggta cttgctgcaa aaatggttgt aaaaattgcc cttatagtta a                351
//

If you have problems or comments...

PBIL Back to PBIL home page