(data stored in ACNUC7421 zone)

EMBL: CR954246.PE444

CR954246.PE444       Location/Qualifiers
FT   CDS_pept        479790..480011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0461"
FT                   /product="putative orphan protein"
FT                   /function="6.2 : Hypothetical"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0461"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85558"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFQ7"
FT                   /protein_id="CAI85558.1"
FT                   /translation="MFILASVQLRHKQLVALRSNGKIAGNSLHQHADMSVTLQVRAALH
FT                   WVQLIWVIILLLNHGERRITILWIYKKH"
     gtgtttattt tagccagcgt acagttacgg cataaacagc ttgtagcgtt aagatctaac        60
     ggtaaaatag cgggtaactc gttgcaccaa catgctgata tgtcagtcac attacaggta       120
     agagcagcat tacattgggt gcagttaatt tgggtcatta ttttactttt aaatcacggt       180
     gagcgcagaa taacaatatt atggatatac aaaaagcatt ag                          222
//

If you have problems or comments...

PBIL Back to PBIL home page