(data stored in ACNUC7421 zone)

EMBL: CR954246.PE445

CR954246.PE445       Location/Qualifiers
FT   CDS_pept        479990..480313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0462"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0462"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85559"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFQ6"
FT                   /protein_id="CAI85559.1"
FT                   /translation="MDIQKALAQFITFGSEKDEAIDVIVSAAAAKQPLFTLSTSIMLNV
FT                   FERCLHNEIVLDDLELWANVIEARDDIDCAECEGVIYALSNSEQMGELNYEKLAKLATL
FT                   LQE"
     atggatatac aaaaagcatt agcgcagttt attaccttcg gctcagaaaa agacgaggct        60
     attgatgtca ttgtatctgc ggcagcagca aaacagccat tatttaccct aagtacgtca       120
     atcatgctaa atgtgtttga gcgttgttta cataatgaaa tagtacttga tgacttggaa       180
     ctgtgggcaa atgtgattga ggcgcgagat gatattgatt gcgctgaatg tgagggcgtt       240
     atttatgcac ttagtaacag tgagcaaatg ggcgagctta attatgaaaa gctcgccaaa       300
     ttagccacgc ttttacaaga gtaa                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page