(data stored in ACNUC7421 zone)

EMBL: CR954246.PE447

CR954246.PE447       Location/Qualifiers
FT   CDS_pept        481647..484076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0464"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0464"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85561"
FT                   /db_xref="GOA:Q3IFQ4"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR032534"
FT                   /db_xref="InterPro:IPR033413"
FT                   /db_xref="InterPro:IPR034032"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFQ4"
FT                   /protein_id="CAI85561.1"
FT                   /translation="MQKIKLLGYILFTVLLTMITQAHAAIKSIDEFTGKMNHFPGYFSF
FT                   FYDTENGKVYLKVDKLEQQFLLQQSLPNGLGSNDIGLDRGQLGNTHLVQFERFGDKVML
FT                   RAVNTYYRANTSNKAEQQSINEAFASSILAGFKVVAQNKRALLIDYTPYLLSDVHGVNR
FT                   TLAATKQGNFNLDESRSAVYMSRSKAFINNTELEAVLTFAGTQPGKFVREISPDAYSLT
FT                   VHMHHSLIKLPDDNYTPRNFHPQSGFWSIEHKNYAAALGESMYVRYIPRHRLTKKDPSL
FT                   PISEPIEPIVYYLDPGVPEPVKSALLEGAQWWDEAFSAAGYKNAFIIKVLPTNADPMDI
FT                   RYNVVQWVHRATRGWSYGSSVIDPRTGEIIKGHVTLGSLRVRQDILIAEALAAPYLNGN
FT                   EIAKALQAMALDRIRQLSAHEIGHTLGISHNFAASVGDRASVMDYPHPLLSFDEQGKLD
FT                   VSRGYATGMGVWDTQVIKYGYSDFTNQNETAALAAILKENNTKGLEFISDSDARAAGGA
FT                   HPTAHLWDNGAAPSEELLRVLEVRKQALAQFGIHNIKTGEALSQLEEKLVPLYLFHRYQ
FT                   VEAVAKLIAGVNYKYEVRGDKPVKGAQVVAKPAQQQAVKAILTTLEGRNLVLPESILAL
FT                   IPPKAYGESRTRESIVGRTGLTLDAMALPEVAVQHSLSLLLNAQRLNRLAQQQARSDDF
FT                   YSLDELLLQLYKQVFVALPSNNMVAKITQRVQFLSAKTMADLVASDNVSPEVQAQLRYY
FT                   LTKLKDDFEQNSLLSNTSIGESAFKQYLAEQVNLFLTTGSWPDNFKALPIPPGSPI"
     atgcaaaaaa taaaactact aggttacatt ctctttactg tgttgctcac tatgataact        60
     caagcgcacg cagcaattaa gtctattgat gaatttactg gaaagatgaa tcattttccg       120
     ggatattttt cattttttta cgataccgaa aacggcaagg tttatttaaa agtagataaa       180
     ctagagcagc aatttttgct acagcaaagc ttgccaaatg gcttgggctc taacgatata       240
     gggctcgata gagggcagct tggtaataca cacttagtgc aatttgagcg ctttggcgac       300
     aaagtaatgc tacgtgctgt aaatacttac tatcgcgcaa ataccagtaa taaagccgag       360
     cagcaaagta ttaatgaagc gtttgcatca agtatattag cgggctttaa agtggttgcg       420
     caaaataagc gggcgctatt aatcgattac actccgtatt tacttagtga tgtacacggt       480
     gtaaatcgaa ccctggcagc gactaaacaa ggtaacttta atctagacga atcgcgtagt       540
     gcagtttata tgagtcgctc taaagcattt attaataata cagagcttga agctgtgctg       600
     acctttgccg gtactcaacc gggtaagttt gtgcgtgaaa taagccctga cgcttattcg       660
     ttaactgtgc atatgcacca ttcactaatt aaattaccag acgataacta caccccgcgc       720
     aacttccatc cacaatcggg tttttggagt attgagcata aaaactatgc tgcagcactt       780
     ggtgagtcta tgtatgtgcg atatataccg cgccatcggt taactaaaaa agatccgagt       840
     ttacctatta gcgagcccat tgagccgatt gtttattacc ttgatcctgg ggtgccggag       900
     ccggtaaaaa gtgcattgct tgaaggtgca cagtggtggg atgaagcgtt tagtgcagcg       960
     ggttataaaa atgcatttat aataaaagta ctaccaacaa acgctgatcc tatggatatt      1020
     cgctacaacg tagtgcagtg ggtgcatcgt gctactcgtg gttggtcgta tggcagttcg      1080
     gtaattgatc cgcgcaccgg cgaaataata aaagggcatg taacgcttgg ttcactgcgc      1140
     gtacgccaag atattttaat tgcagaagcg ctggctgcgc cttacttaaa cggcaatgaa      1200
     atagcaaaag ctctacaagc catggcgctt gatcgtatta ggcagttaag tgctcacgaa      1260
     attgggcata ccttggggat ttctcataac tttgccgctt cagtgggcga tagagcctcg      1320
     gtaatggatt atccgcatcc gctgcttagc tttgatgaac aaggcaagct tgatgtgtca      1380
     cgcggttatg ctacgggtat gggcgtgtgg gatacacaag ttattaaata cggctacagc      1440
     gactttacta atcaaaacga aacagcagca ttggcggcta ttttaaaaga aaacaacact      1500
     aaagggctcg agtttatatc tgatagcgac gcacgcgctg ccggtggtgc gcatcctacg      1560
     gctcatttgt gggataacgg cgcagcacca agcgaagagc tattaagagt actagaagtg      1620
     cgtaagcaag cactcgcaca atttggtatt cataatataa aaacgggaga ggcgttatcg      1680
     caattagaag aaaaactggt gcccttgtat ttatttcacc gttaccaagt agaggcggtg      1740
     gctaaattaa ttgctggagt aaattacaag tacgaagtac gcggtgataa acctgtaaaa      1800
     ggcgcgcaag tggttgctaa gccagcgcaa caacaagcgg ttaaagctat tttaaccact      1860
     cttgagggcc gtaatttagt gttgccagag tcaatactcg cacttattcc acctaaagcg      1920
     tatggtgagt ctaggacgcg tgaaagtata gtggggcgca ctggtttaac ccttgatgct      1980
     atggcgttac ctgaagttgc cgtgcagcat agcttatcgt tattactaaa tgcacagcgt      2040
     ttaaatcgcc ttgcgcaaca acaagcacgc agtgatgatt tttatagttt agatgagtta      2100
     cttttacagc tttataagca ggtttttgtg gcattgccat ccaataacat ggtggcaaag      2160
     atcactcagc gagtgcaatt tttaagtgct aaaacaatgg ctgatttagt ggccagcgat      2220
     aacgtaagtc cagaagtaca agcacaactg cgttactatt taactaagct aaaagatgac      2280
     tttgaacaaa actcactact aagcaacacc agtataggtg aaagcgcgtt taaacaatat      2340
     ttagctgaac aagttaacct gtttttaacc acaggtagct ggccagataa ctttaaagca      2400
     ttaccaatcc cgccaggttc gccaatttaa                                       2430
//

If you have problems or comments...

PBIL Back to PBIL home page