(data stored in ACNUC7421 zone)

EMBL: CR954246.PE448

CR954246.PE448       Location/Qualifiers
FT   CDS_pept        484287..485060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0465"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85562"
FT                   /db_xref="InterPro:IPR021307"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFP2"
FT                   /protein_id="CAI85562.1"
FT                   /translation="MAFLSRSILALSVALLSNNVFAQKQCDVELRHGLIITDDIIRIVD
FT                   KGQTRVQINNNNQLFIRGYWIDLSDDESKVLEQFSSGIRQTVPELVNLATDGVNLGLSA
FT                   IEHVVEGMTDKESEVLKTQLQYVERALMDKFKRGDDFFFIAPQSLSKIDDFFTKDISKK
FT                   IHSAVHGSLGAILMSLGDAFKSREGNIEDRMNDMSQRMDIISSEIDKSLQEKARQLELK
FT                   AAEYCECLNALDVTESRLQAIVPGMVNFDLVQIKS"
     atggcgtttt tatctcgttc gatattggcg ttgtctgtag cacttttaag caataacgta        60
     tttgcgcaaa agcagtgtga tgtagagctt cgtcacggtt taatcattac tgatgatatt       120
     attcgcattg ttgataaagg ccaaacccgc gtacaaatta ataataataa ccaattgttt       180
     atccgtggct attggattga cttaagtgat gacgaaagta aagtccttga gcagtttagc       240
     agcggtattc gtcaaactgt tcctgaactc gttaacttag ccaccgatgg tgttaattta       300
     gggctcagtg caattgagca tgttgttgaa ggcatgacag ataaagaatc agaagtgctt       360
     aaaacgcaat tgcagtacgt tgaacgtgcg ctaatggata agtttaaacg cggcgatgat       420
     tttttcttta ttgcgccgca atcactttcc aaaatagacg actttttcac taaagatatt       480
     agcaaaaaaa ttcactcggc agtgcatggc tccctcgggg ctattttaat gtcgttaggc       540
     gatgcattta aatcgcgcga aggtaatatt gaagatcgaa tgaacgacat gagccaacgc       600
     atggatatca tttcttcaga aatagataaa tcactccaag aaaaagcccg ccaactcgaa       660
     cttaaagccg cggaatactg cgaatgttta aatgcccttg atgtaaccga atcccgcctt       720
     caggccatag tacctggcat ggtgaacttt gacttagtgc aaataaagtc ttaa             774
//

If you have problems or comments...

PBIL Back to PBIL home page