(data stored in ACNUC7421 zone)

EMBL: CR954246.PE45

CR954246.PE45        Location/Qualifiers
FT   CDS_pept        49800..50390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0049"
FT                   /product="conserved protein of unknown function ; putative
FT                   methylase"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85159"
FT                   /db_xref="InterPro:IPR010342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF09"
FT                   /protein_id="CAI85159.1"
FT                   /translation="MIKPFSQACENNKQPILAQLKPVLANAKTVLEIGSGTGQHSVYFA
FT                   QQLPHLQWYSSDRAINHEGINLWHRDVNLTNLHVPLELDLNNAWPIDKVDAIYTANTFH
FT                   IVSWQLVEHFFAGVKQHLNDQGIVCIYGPFKYKGEFTSQSNNDFNRFLIERDPLSGIRD
FT                   FAAVELLAKQAGLTLISDIAMPANNQLLIFKRQ"
     atgatcaagc cattctcaca agcgtgtgaa aataataaac agcctatttt agcgcagtta        60
     aaacctgtgt tagcgaatgc caaaacggtg ctcgaaatag gctcaggtac aggtcagcac       120
     agcgtgtact ttgctcagca gttgccgcat ttacaatggt atagcagcga cagagcgatt       180
     aatcatgaag gtattaattt atggcaccgc gatgttaatt taaccaattt acatgttccc       240
     cttgaacttg acttaaacaa tgcgtggcca atagataaag tggatgctat ttacacggct       300
     aatacttttc atattgtaag ctggcaactt gtagagcatt tttttgcggg tgtaaaacag       360
     catttaaatg accaaggcat agtatgtatt tacgggccat ttaaatataa aggcgagttt       420
     actagccaaa gtaataacga ctttaatcgc tttttaatag agcgcgaccc acttagcggt       480
     attagagatt ttgcagcagt tgagctatta gcaaagcaag cagggctaac gttaataagt       540
     gatatagcca tgcctgctaa taatcagtta ctgattttta aacggcagta a                591
//

If you have problems or comments...

PBIL Back to PBIL home page