(data stored in ACNUC7421 zone)

EMBL: CR954246.PE451

CR954246.PE451       Location/Qualifiers
FT   CDS_pept        487172..488281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0468"
FT                   /product="conserved protein of unknown function ; putative
FT                   ATPase"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85565"
FT                   /db_xref="GOA:Q3IFQ1"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFQ1"
FT                   /protein_id="CAI85565.1"
FT                   /translation="MTVQDTQIISLYQAKVASGELSFDAAQNNAVQALNSLSEQLQMHY
FT                   SWWQKSPLIKGVYLYGPVGRGKSMLMDLFYNNVAISKKQRLHFHHFIAQVHQQLGQLQG
FT                   QKDPLIIIAKNWAKNIRVLCFDEFFVSDIGDAMIMARLFDALFKQGVVLVATSNAKPEQ
FT                   LYYNGLQRARFLPTIDLINNYCEIVNVAGEEDHRFRYGKNSSHYFINLPSDDFKAKFLT
FT                   QYPQASHSGNITVHGRALPYLLKTANALMIDFMALCSGPRSANDYMFLAQQFSVLYVAN
FT                   VPKMGVGATGKVIVHGIEDSYQREKQTLDEHFFDDEARRFIALVDEFYDCHKLLVINAQ
FT                   ADIDTLYQGKKLSFEYARTQSRIVEMQNW"
     atgacagtgc aggacacaca aataataagc ctttaccaag ctaaggttgc atcgggcgag        60
     cttagcttcg atgctgcgca aaataatgcc gtacaggcac ttaattcgct tagtgaacaa       120
     ttacaaatgc actatagctg gtggcaaaag tcgcctctca taaaaggtgt gtatttgtat       180
     gggccggtag ggcgtggtaa atccatgcta atggatttat tttataacaa tgttgctata       240
     agtaaaaagc agcggctgca ttttcatcac tttatagcgc aggtacacca gcagttaggg       300
     cagttacaag ggcaaaaaga tccgttaata attatagcta aaaattgggc caaaaatatt       360
     cgggtgctat gttttgatga gttttttgtt agcgatattg gcgacgctat gattatggct       420
     cggctgtttg atgcgttatt taaacaaggt gtagtgttgg tggccacttc aaacgcaaaa       480
     ccagagcagc tttactataa tggcctacag cgagcacggt ttttacctac tatagattta       540
     attaataatt attgcgagat agtaaatgta gcgggagagg aggatcatcg ttttcgttat       600
     ggtaaaaata gtagtcatta ctttattaat ttacccagtg atgactttaa agctaaattt       660
     ttaacgcagt acccgcaagc atcgcacagt ggcaatatca cggtacacgg tagagcgctg       720
     ccttatttat taaaaacagc aaatgcctta atgattgatt ttatggcgtt gtgctctggc       780
     ccgcgtagcg ctaacgatta catgttttta gctcagcaat tttctgtgtt atacgtggca       840
     aatgtgccaa aaatgggcgt tggcgcaacc ggtaaagtaa tagtgcacgg tatagaggac       900
     agctaccagc gtgaaaaaca aactctagac gagcactttt ttgatgatga agcacgacgt       960
     tttattgctt tggtcgatga gttttatgac tgccataagt tactggttat aaatgcacag      1020
     gctgatatag acaccttgta tcaaggtaaa aaactaagct ttgaatatgc acgaacgcaa      1080
     tcgcgtatag tcgaaatgca aaattggtaa                                       1110
//

If you have problems or comments...

PBIL Back to PBIL home page