(data stored in ACNUC7421 zone)

EMBL: CR954246.PE453

CR954246.PE453       Location/Qualifiers
FT   CDS_pept        489751..490242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0470"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85567"
FT                   /db_xref="InterPro:IPR021557"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFP9"
FT                   /protein_id="CAI85567.1"
FT                   /translation="MNPVNKIAMLMCFALPALAHAGESAIKWHDFKDYRDVRESNQGKA
FT                   SYHKHIASSIEEHVAKLAEQLPKDYKLSLEITDVDLAGDVRYGGINEIRVVKPIYFPQL
FT                   KLNYSLTNDKGEVISAASDVKLKDMGFMDKIKMGRDEPFNYEKRLLTEWFGEEILSKVD
FT                   "
     atgaatccag taaacaaaat cgcaatgtta atgtgctttg cactaccagc acttgcccat        60
     gcgggtgagt cggctattaa atggcatgat tttaaagact atcgtgatgt acgcgaatcc       120
     aatcaaggta aagcttcgta ccataagcat atagcgagca gtattgaaga gcatgttgct       180
     aaacttgcag agcaattgcc aaaagactac aaacttagcc tagagattac tgatgtcgat       240
     ttagctggcg atgtacgcta tggcggtata aatgaaatta gggtggttaa gcctatttat       300
     tttccgcaac tcaaacttaa ttattcactt accaatgata aaggtgaggt aataagtgca       360
     gcaagtgatg taaagctcaa agatatgggc tttatggata aaattaaaat gggccgagat       420
     gagccattta attacgaaaa acgcttactt acagagtggt ttggtgagga aatattatcg       480
     aaagttgatt aa                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page