(data stored in ACNUC7421 zone)

EMBL: CR954246.PE454

CR954246.PE454       Location/Qualifiers
FT   CDS_pept        complement(490322..490612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0471"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0471"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85568"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFP8"
FT                   /protein_id="CAI85568.1"
FT                   /translation="MDSIIEQLNANLKIVYRQALDADKKLDELQQQGHGKFKALFTADS
FT                   GFTFEAKRFKPYVLDVAADVESLSSDGFNEEKLKTTVIKLQQLLTLLATFK"
     atggattcta ttattgaaca actcaacgct aacttaaaaa ttgtttaccg acaggcgctt        60
     gatgctgaca aaaaactcga cgagttacaa cagcaaggtc acggcaaatt taaagcactc       120
     tttacagccg actcaggttt tacctttgaa gctaaacgct ttaagccata tgtgcttgat       180
     gtagcagccg acgtagagag cttatctagt gacggtttta atgaagaaaa acttaaaacc       240
     accgttatta aattacagca actacttact ttgttagcta cgtttaagta a                291
//

If you have problems or comments...

PBIL Back to PBIL home page