(data stored in ACNUC7421 zone)

EMBL: CR954246.PE455

CR954246.PE455       Location/Qualifiers
FT   CDS_pept        490781..490990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0472"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85569"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFP7"
FT                   /protein_id="CAI85569.1"
FT                   /translation="MNISGGNLPVMPSSSQGGEVLSAALSKKQQLADGAAALALIEGAA
FT                   QSSSAQTPTQSATATLGNNVNIYV"
     atgaatatat caggcggaaa tttaccggta atgccaagtt caagccaagg cggcgaagtg        60
     ttgagcgctg cattgtctaa aaaacagcaa ctagcggatg gcgcagctgc attagcactg       120
     attgagggtg ctgcgcagtc atccagcgcg caaacaccga ctcagtcggc gactgcaaca       180
     ctgggtaata acgtaaacat ttacgtttaa                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page