(data stored in ACNUC7421 zone)

EMBL: CR954246.PE458

CR954246.PE458       Location/Qualifiers
FT   CDS_pept        492680..493654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0475"
FT                   /product="putative fold recognizing lysyl-tRNA"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 5653192"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85572"
FT                   /db_xref="GOA:Q3IFP4"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004525"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IFP4"
FT                   /protein_id="CAI85572.1"
FT                   /translation="MSVNLWAPSASIATLKQRAVILRSIREFFYARNVMEVETPSLSGA
FT                   SVTDIHLVSFNTRFVGPGHASGLELYLQTSPEFAMKRLLAAGSGPIFQLCKAFRNEEAG
FT                   SHHNPEFTMLEWYRPGFDEFALMAEIDELMQLILDVAPSERLTYQHAFEQVLGLDPLTA
FT                   SLEQLQQLACEQGFADIAKNETHRDTLLQLLFCMKVEPTIGQHKPCFVYHFPASQAALA
FT                   QICDHDSRVAGRFELYYKNMELANGFNELTNATEQAKRFNDDNEYRKQNGLKQVPMDKH
FT                   LIAALEHGLAPCAGVALGIDRLVMLATQKSNIKEVIAFDVTRA"
     atgtcagtaa atctttgggc tcccagtgca agtattgcaa cacttaagca gcgagctgtt        60
     attttacgca gtattcgcga gttcttttat gctcgcaatg taatggaagt agaaaccccc       120
     agtttaagcg gagccagtgt aaccgatata cacttagtga gttttaacac tcgatttgta       180
     ggcccagggc acgccagcgg ccttgagcta tatttacaaa cctctccaga gtttgcaatg       240
     aagcgcttgt tagcggcggg ctcagggcct atatttcagt tgtgtaaagc atttagaaac       300
     gaagaagctg gcagccatca taatccagaa tttactatgc tggaatggta tagaccgggg       360
     tttgacgaat ttgcattaat ggctgaaata gatgagctaa tgcagcttat tttagatgtt       420
     gcgccgagtg aacggttaac ttaccaacac gcatttgaac aagtacttgg acttgatcct       480
     cttactgcta gtttagagca attacaacaa cttgcctgcg agcaagggtt tgctgatata       540
     gctaaaaatg aaacgcatag agatacctta ctgcagcttt tattttgtat gaaagtagag       600
     ccaacaattg gccaacataa gccgtgtttt gtgtatcact ttccggcatc gcaagcagca       660
     ctggcacaaa tttgcgatca tgacagtcgc gtagcagggc ggtttgagct gtattataaa       720
     aatatggaat tagctaatgg ctttaacgag ctaactaatg cgacagagca agctaagcgt       780
     tttaatgacg ataatgaata tcgtaaacaa aatggcttaa agcaagtacc aatggataag       840
     catttaattg ctgcgctgga acatggatta gcgccttgtg caggggtagc gctgggcata       900
     gacaggctag taatgttagc cacgcaaaag agtaatataa aagaagttat tgcgtttgat       960
     gtgacaagag cttaa                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page