(data stored in ACNUC7421 zone)

EMBL: CR954246.PE459

CR954246.PE459       Location/Qualifiers
FT   CDS_pept        complement(493796..495895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0476"
FT                   /product="putative TonB-dependent receptor"
FT                   /function="1 : Cell envelope and membrane-associated
FT                   cellular processes"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0476"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85573"
FT                   /db_xref="GOA:Q3IFP3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFP3"
FT                   /protein_id="CAI85573.1"
FT                   /translation="MNLRLSLITAALLPLFGASVTANADDTDLERIVVTGDFQRESIQT
FT                   LSASASLFSEDEVNLRGATYLDEMLGSTANINFASGASRGRYIQIRGVGLRSQFVDPIN
FT                   PSVGLVIDGINYSGLGGSALLFDIDQVEIYRGPQGTRFGADGMAGMIQMQSAQATSDPS
FT                   LKLQVGAGTYNSREAGLAASTGLTDDTSARVSYFRRKSDGYVDNLYLNKPTQGQDEQVA
FT                   RFKLNSQITANLRTELNLHYIDINNGYDTFALDNGRNSVADEPGEDNQLSYAIGLNNTY
FT                   TGFDLFDVNLSLSAIDSELFYSFDEDWVCNDPSKPQLCAAGLHPDGYSSTDVYSRDRDD
FT                   QGVDLQFKSKTGNWVAGLYYQNRDVDLERQYTWLASPFNSTYETNNVAVYGQLATPIGP
FT                   KTTLITGLRVEQYQGDYTDNNGFIEDTDDIMVGGKIALEYQVIDRTMIYTSITRGYKAG
FT                   GINSEALAKAKDEGLNLDAEFFKQHTSFDPEYLWSGEFGVKGSSLDDKFILRLAAFYMH
FT                   RDNIQLKSWQVQDQKFTGYVDNASSGSNYGLELEGSYQLTDDLLITGSAGYLNTKINKF
FT                   VTKAGLNQDGRDQAQSPKYQYALSARYNLTNELYAMVGVEGKDDYYFSDSHNAQAPNSN
FT                   LVNVSLGYEADSWAVRAWARNVFDETVPTRGFEFGNNPLDGYADHTYTQLGEPRVAGVT
FT                   FTLNL"
     atgaacttac gtttgtcttt aattaccgcc gcattattac cactgtttgg tgcatcagtt        60
     accgccaacg ctgacgatac agatctagaa cgcattgttg ttactggtga ttttcaacga       120
     gaaagcattc aaaccttaag tgctagcgcc agcttattta gcgaagatga agttaattta       180
     cgaggtgcaa cctacctaga tgaaatgctt gggagtactg ccaatattaa ttttgcttct       240
     ggagcttctc gcggtcgtta tattcaaatt cgtggcgtag gactacgttc acagtttgtt       300
     gaccccataa atccttcggt tggtttagtt attgatggca ttaactactc aggccttggt       360
     ggcagtgcat tattatttga tattgaccaa gtagaaattt accgtggccc acaaggtaca       420
     cgctttggtg ccgacggtat ggcaggtatg atccaaatgc aatcggcgca agcaacaagc       480
     gatcctagtt taaaactaca agtaggtgca ggcacttaca acagccgcga agcaggtctt       540
     gctgcaagta caggtttaac cgacgatacc agcgctcgtg ttagctactt tcgtagaaaa       600
     tcagacggct atgtagataa cctataccta aataagccaa ctcaagggca agacgagcaa       660
     gtagcacgct ttaaattaaa cagccaaata actgccaatt tacgcactga attaaatcta       720
     cactatattg acattaacaa cggttacgac accttcgcac ttgataacgg ccgtaacagc       780
     gttgccgatg aacccggtga agataaccaa ttaagttacg ctattggtct aaataacact       840
     tatacgggct ttgatttatt tgacgtaaac ttaagtttat cggcgatcga cagtgaatta       900
     ttttatagct ttgatgaaga ttgggtatgt aacgatccga gtaaaccgca gctttgcgcc       960
     gccggtttgc atcctgatgg ttacagctca actgatgttt acagccgcga tcgcgatgat      1020
     caaggggtcg atttacaatt taaaagtaaa accggcaact gggttgcagg tctttactat      1080
     caaaaccgcg acgtagattt agagcgccaa tacacctggt tagctagccc atttaactca      1140
     acgtatgaaa ccaataacgt ggcagtatac ggccaattag caactcctat tgggcctaaa      1200
     accactttaa ttaccggctt acgtgttgag caataccaag gtgattacac cgataataac      1260
     ggttttattg aagataccga cgacattatg gttggcggaa aaatagcgct tgagtaccaa      1320
     gtaattgatc gcaccatgat ctacaccagt attacccgtg gttataaagc aggcggcatt      1380
     aactcagaag cgctcgccaa agctaaagat gaaggcttaa acctcgacgc cgaatttttt      1440
     aaacagcaca ccagttttga tccagaatac ttatggagcg gtgagtttgg tgttaaggga      1500
     tcatcccttg atgataaatt tattctacgt ttagctgcgt tttacatgca ccgcgacaac      1560
     attcagttaa agtcatggca agtacaagat cagaagttta ccggttatgt agataacgcg      1620
     agctctggca gtaactatgg ccttgaactt gaaggtagct atcagctaac cgacgattta      1680
     cttattaccg gtagtgctgg ttatttaaat actaaaataa ataaatttgt aactaaagcg      1740
     ggtttaaacc aagacggtcg cgaccaagca cagtcaccta aatatcaata cgcactgagt      1800
     gctcgttata accttaccaa cgagctttat gccatggtag gtgttgaagg caaagacgat      1860
     tattacttct cagatagcca taatgcacag gcaccaaaca gtaacttagt gaatgtaagc      1920
     ttaggttatg aagccgatag ctgggctgta cgcgcctggg cacgtaacgt gtttgacgaa      1980
     acagtaccta ctcgcggttt tgagtttggc aacaacccac ttgatggtta cgctgatcat      2040
     acctacaccc aacttggtga accacgtgta gctggcgtta cttttacact taatttataa      2100
//

If you have problems or comments...

PBIL Back to PBIL home page