(data stored in ACNUC7421 zone)

EMBL: CR954246.PE46

CR954246.PE46        Location/Qualifiers
FT   CDS_pept        complement(50367..51506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0050"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85160"
FT                   /db_xref="InterPro:IPR007434"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF08"
FT                   /protein_id="CAI85160.1"
FT                   /translation="MATFSHQWFSSINQIERAHWQRLFGDEPFTQHAFLYALEQSQCVN
FT                   QQSGWQPYHLAIFEGENIIALAPGYLKSHSYGEYVFDWAWAEAYEKHGLEYYPKWLCGV
FT                   PFCPIEGSRIAIEHSNPSLVYKYITELLNLHSKEQGWSGWHVNFCNLAQATHLTEQHAM
FT                   LRVGVQFQWFNKGFTCFDDFLNTLNSRKRKSLKKERSKITQQNITIEWLQGMQITPEIM
FT                   QLFCEFYQRTYLKRSGHLGYLNMPFFKLLHALMADKLVIMLAKKEDAIIAATLSLIGAD
FT                   TLYGRYWGASEEVDSLHFELCYYQGIEFAIKHNLSCFHSGAQGEHKIARGFAPVLTYSA
FT                   HHIVDNNFSNAISDYLKRERQHINIYKDQCSALLPFKNQ"
     atggcgacat tttcgcatca atggtttagt agtattaatc aaatagagcg agcgcattgg        60
     caacgtttgt ttggcgacga gccatttacc caacatgctt ttttatacgc attagagcaa       120
     agtcagtgtg ttaatcaaca aagtggttgg cagccttatc acttagctat ttttgagggc       180
     gaaaatatta ttgcgctggc acctggctat ttaaaaagcc actcttacgg tgaatatgtg       240
     tttgattggg cctgggcaga agcatacgag aaacatggct tagagtacta ccctaaatgg       300
     ttatgcggtg tgccattttg ccccattgaa ggtagccgta ttgctataga gcatagcaat       360
     cctagtttag tgtataaata cattacagag ttactaaacc tgcacagcaa agagcaaggc       420
     tggtctggtt ggcacgttaa tttttgcaac ttagcccaag ccacacacct cactgagcaa       480
     cacgccatgc ttagagtggg tgtgcaattt cagtggttta ataaaggctt tacatgcttt       540
     gacgattttt taaatacgct taattcacgt aagcgtaaat cactaaaaaa agaacgcagc       600
     aaaataactc aacaaaacat tactattgaa tggctgcaag ggatgcaaat tacgcctgaa       660
     attatgcagc tattttgcga attttatcaa cgtacttatt taaaacgctc tggccactta       720
     ggctatttaa atatgccctt ttttaagctt ttacatgcgc taatggccga caagctagtc       780
     attatgctag ccaaaaaaga ggacgctatt attgccgcaa cccttagtct aataggagca       840
     gatacactgt atgggcggta ttggggggca agcgaagagg tagattctct gcactttgaa       900
     ctatgctatt accaagggat tgagtttgca ataaagcata acctcagctg ttttcattca       960
     ggggcacaag gtgaacataa aatagcacgc ggttttgccc ctgtattaac ctactcagct      1020
     caccatatag ttgataataa ctttagcaac gcaattagcg attacttaaa acgtgaacgc      1080
     cagcatatta atatttataa agatcaatgc agcgcattac tgccgtttaa aaatcagtaa      1140
//

If you have problems or comments...

PBIL Back to PBIL home page