(data stored in ACNUC7421 zone)

EMBL: CR954246.PE460

CR954246.PE460       Location/Qualifiers
FT   CDS_pept        495998..496399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0477"
FT                   /product="conserved protein of unknown function ; putative
FT                   thioesterase superfamily"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0477"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85574"
FT                   /db_xref="GOA:Q3IFP1"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFP1"
FT                   /protein_id="CAI85574.1"
FT                   /translation="MTFTVDFKVRDYECDLQGIVNNSVYFNYLEHARHEFLHAHGVDFA
FT                   QLAKDKINLVVMRSEMDYKQSLLPGDEFYVAVEPQRISRLKFAFKQTLIRKHDEKIMLN
FT                   ALVIGTALNEKGRPFLPAQIDNLFKTDSE"
     atgaccttta cagtagactt taaagtgcga gactacgaat gcgacctaca aggcattgta        60
     aataatagtg tgtattttaa ttacttagag catgcgcgcc atgaattttt gcatgcacat       120
     ggggttgatt ttgctcagct tgccaaagat aaaattaacc tggtcgtgat gcgcagcgaa       180
     atggattata aacagtcatt attaccgggt gatgaatttt atgtagctgt agagccacaa       240
     cgtattagcc gacttaaatt tgcttttaaa caaaccctga tccgtaaaca cgatgagaaa       300
     ataatgctta atgcattggt aatcggcaca gctttaaatg aaaaaggtcg gccattttta       360
     ccagcgcaaa tagataattt atttaaaacg gattctgaat aa                          402
//

If you have problems or comments...

PBIL Back to PBIL home page