(data stored in ACNUC7421 zone)

EMBL: CR954246.PE461

CR954246.PE461       Location/Qualifiers
FT   CDS_pept        496544..496921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0478"
FT                   /product="putative heat shock protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 8349564; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0478"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85575"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFP0"
FT                   /protein_id="CAI85575.1"
FT                   /translation="MLIIGLCVGCASTQTVTSEQLKHTQWQLSRIDGLAIPPSFNASVG
FT                   FIEALQVNGFAGCNKFFGEGELDDSSLTVNKIGMTRKSCGQQLDKFEQQLLHALQQGAQ
FT                   LKMQDQQLVMQGEKTFVFIAK"
     atgcttataa tcggtttatg tgttggttgt gcatcaacgc aaacggttac ctcagagcag        60
     cttaaacata ctcaatggca gttatcacgt attgatggcc tagctattcc gccttcgttt       120
     aatgcgtcgg tgggttttat tgaagcactg caagtcaatg gttttgctgg ctgcaataaa       180
     ttttttggtg aaggtgagct ggacgatagt agcttaacag ttaacaaaat agggatgacc       240
     cgtaagtcgt gtggccaaca acttgataag tttgagcagc agttactaca cgcactgcaa       300
     caaggcgcgc agcttaaaat gcaagaccag caattggtaa tgcagggcga gaaaacattt       360
     gtatttattg ctaaataa                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page