(data stored in ACNUC7421 zone)

EMBL: CR954246.PE469

CR954246.PE469       Location/Qualifiers
FT   CDS_pept        complement(504739..505797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0487"
FT                   /product="putative GTPase engC precursor"
FT                   /EC_number="3.6.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0487"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85583"
FT                   /db_xref="GOA:Q3IFN2"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFN2"
FT                   /protein_id="CAI85583.1"
FT                   /translation="MAKQKKLSKGQSRQIKANHQKRISSADARPAKKGAQEWQTDNLGQ
FT                   VESAIVISRFGQHADVEVESGEVLRCNIRRTVSNLVCGDEVLFRRAKVSEGDLAGVIEA
FT                   TQERRSQLTRPDFYDGVKVIAANIDQILMVSAVLPEFTPSIIDRYLIACEDMGIEPILV
FT                   LNKIDLIDAQGLSEIQKVLDVYRKLDYKVLLVSNISTDGIDELKDVLVGKNNIFVGQSG
FT                   VGKSTLVNTVLPDAEILTKEVSENSGLGQHTTTVSRLHHLPSGGNLIDSPGIREFGLWH
FT                   LEVDRVTWCFKEFREFIGGCRFRDCKHLNDPGCIIKEAVADGKISQLRFDSYHRILETM
FT                   ADGRAGSRAPRV"
     gtggcaaaac aaaaaaaatt aagtaaaggc cagtctcgtc agatcaaggc taatcatcaa        60
     aagcgtataa gcagtgctga tgcaaggcct gctaaaaaag gtgcgcaaga atggcaaacc       120
     gataatttag gccaagtaga aagcgctatt gtgatcagtc gttttggtca acatgctgat       180
     gtggaagttg aaagcggcga agtactacgc tgtaatatac gccgcactgt gtctaattta       240
     gtgtgtgggg atgaagtact gtttcgtcgc gctaaagtaa gcgaaggcga tttagctggt       300
     gtaattgaag caacgcaaga gcgtcggtca caacttactc gccctgattt ttacgacggt       360
     gtaaaagtaa tagctgctaa tattgaccaa atattaatgg tgtcagcagt attacccgaa       420
     tttaccccaa gtattatcga ccgttattta atagcctgcg aagatatggg tatagagcct       480
     attttagtac taaataaaat agatttaatc gatgcgcaag gtcttagtga aatacaaaaa       540
     gtactcgatg tataccgcaa gctcgactac aaagttttat tggttagtaa tataagtacc       600
     gatggtattg acgaattaaa agatgtactc gttggtaaaa acaatatttt tgttggtcaa       660
     agtggcgtag gtaaatctac tttagttaat accgtacttc cagatgctga aattctaact       720
     aaagaagttt ctgaaaacag tggtttaggc caacatacca ccacggtatc tcgcctacat       780
     catttaccaa gcggcggtaa cttaatagat tcaccgggta tacgtgaatt tggtttatgg       840
     cacttagaag ttgatcgtgt aacttggtgc tttaaagagt ttagagaatt tataggcggg       900
     tgtcgattta gagactgcaa acatttaaac gatccgggct gtataattaa agaagccgta       960
     gctgatggca aaatttcgca attgcgcttt gacagctacc acagaatttt agaaacaatg      1020
     gccgatggcc gtgcaggctc tcgcgcgcct cgcgtataa                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page