(data stored in ACNUC7421 zone)

EMBL: CR954246.PE47

CR954246.PE47        Location/Qualifiers
FT   CDS_pept        complement(51509..52879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0051"
FT                   /product="conserved protein of unknown function ; putative
FT                   secreted esterase"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85161"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF07"
FT                   /protein_id="CAI85161.1"
FT                   /translation="MNNNSVFLKIFLTCMLSFLPHLAVAENCIAQASDFEFIKKSKQQG
FT                   LLRYTKDHHQAYFDYQARAPFNSYLNHAYQYISVANPRAAMPCPVFTQTYQQLVTQGSR
FT                   KPNPTIADIIAPFELKHSQSKKAVLLVHGLTDSPFTYHDLAQVYYQQGYTVRTILLPGH
FT                   GSAASALQDVDLQQWQQAVRYAIERTTQDFDEVILGGYSTGAALLIDYAITQALSSKIT
FT                   ALMLFSPGSEPHNKQGWIAKWLDLIPFLNWIDKDADVDFAKYESFPLNAAAASYDAMSL
FT                   VSIKNLSKRPALALPVFSVISDIDATIDSHATLKLLNALHNTNLSRYKKLDTLVLYGSS
FT                   TILPPNFAADYRVLNPQCASEACLKIHGISHIAIVNSPQNPHYGISASYRNCGSFIGGE
FT                   KLYKTCKTTKSPQLGERTAANLKQYPTLQRLTYNPFFPELKKQISTFIKNVEHAQGK"
     atgaacaata atagtgtgtt tttaaaaata tttttaactt gtatgcttag ctttttgcct        60
     cacttagctg tcgctgaaaa ttgtattgcg caggcaagcg attttgaatt tattaaaaag       120
     agtaaacagc aaggcctatt acgctataca aaggatcacc accaagcgta ttttgattac       180
     caagcgcgtg ccccatttaa tagctacctc aatcatgcgt atcagtatat tagtgtagct       240
     aatcctcgcg ctgctatgcc atgccctgta tttactcaaa cgtatcagca actagttact       300
     caaggcagtc gtaagcctaa ccccactatt gccgacatta ttgctccttt tgagttaaaa       360
     cattcacaaa gtaaaaaagc ggtattactc gtgcacggcc ttaccgactc tccttttacc       420
     tatcacgatt tagcccaagt gtattatcag caaggttata ccgtacgcac tattttgtta       480
     cccggccacg gcagtgctgc tagtgcgtta caagatgtag acctacagca atggcaacaa       540
     gctgtgcgtt acgctataga gcgcacaaca caagactttg atgaggttat tttagggggc       600
     tactctacgg gggccgcact acttatagac tatgcaatca cgcaagcgct ttcatcaaaa       660
     ataacggcgc ttatgttatt ttcaccgggc tccgagccgc ataataaaca aggttggata       720
     gccaagtggc ttgatttaat cccattttta aattggatag ataaagacgc cgatgttgat       780
     tttgctaagt atgagtcgtt tccactcaat gctgcagcag cctcatatga tgcaatgtca       840
     ttggttagca ttaaaaactt aagtaagcgc cctgctttgg cattgcctgt atttagcgta       900
     ataagcgata ttgacgcgac aattgatagc catgccaccc ttaaattatt aaatgcacta       960
     cataatacta atttaagtcg ctataaaaaa ctcgataccc tagtgcttta tggtagcagc      1020
     actattttac ccccaaattt tgcagcagat tacagagtat taaatccgca gtgtgccagc      1080
     gaagcatgtc taaaaatcca tggtatatcg catattgcca ttgttaactc accacaaaat      1140
     ccgcattatg gtattagtgc ctcttatcgt aattgcggca gttttattgg cggcgaaaag      1200
     ttatataaaa cctgtaaaac cacaaaaagc ccgcaacttg gagaacgtac agctgctaac      1260
     ttaaagcaat atcccacctt acaacgatta acctataacc ccttttttcc tgagcttaaa      1320
     aaacaaataa gcacctttat aaaaaacgta gaacacgcac aaggtaagta g               1371
//

If you have problems or comments...

PBIL Back to PBIL home page