(data stored in ACNUC7421 zone)

EMBL: CR954246.PE472

CR954246.PE472       Location/Qualifiers
FT   CDS_pept        complement(507477..507905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0491"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85586"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG95"
FT                   /protein_id="CAI85586.1"
FT                   /translation="MSWQQKAITLKPRIRGFHLIDDEILTQIPELTNYKVGLLHLFIQH
FT                   TSASLTINENADPTVRMDMESHFNEFVPQCQPYYRHDYEGDDDMPAHIKTSILGCELSI
FT                   PITNGYLALGTWQGVYLGEHRDNGGTRRIVATIQGELF"
     atgagttggc aacaaaaagc cataacttta aagcctcgta tccgaggctt tcatttaatt        60
     gatgatgaaa tactcactca aatccccgaa ctcacaaatt acaaggtggg tttactgcac       120
     ttatttattc aacacacttc agctagccta accattaatg aaaatgccga ccctactgta       180
     cgtatggata tggagagcca ctttaatgaa tttgttccgc agtgccaacc ctattatcgt       240
     cacgattatg aaggtgacga cgacatgcca gctcatataa aaaccagtat tttaggctgt       300
     gagttaagca tccctattac aaatggctat ttagctttag gtacatggca aggtgtttat       360
     ttaggtgaac atcgagacaa cggtggtact aggcgaattg tagcaaccat tcagggcgag       420
     ttgttttaa                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page