(data stored in ACNUC7421 zone)

EMBL: CR954246.PE473

CR954246.PE473       Location/Qualifiers
FT   CDS_pept        complement(507902..508369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0492"
FT                   /product="conserved protein of unknown function ; putative
FT                   CheC-like protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0492"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85587"
FT                   /db_xref="InterPro:IPR028051"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR038756"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG94"
FT                   /protein_id="CAI85587.1"
FT                   /translation="MNVEFINPFLSSLINVLSTMAQTQLKPGKPRIKTDEKACGDVSGL
FT                   IGMVGPQTRGSFSITFDEQLALTIMERMLGERPDSINEEVTDMVGEITNMVTGGAKNLL
FT                   GQKGFDFDMATPIVVSGKDHTITHKSQGKKILMPFTCDAGNANIEVSFDKL"
     atgaatgtag agttcatcaa ccctttttta tcttctttga tcaatgtatt aagtacaatg        60
     gctcaaacac aattaaagcc aggtaagcca cgcattaaaa ctgatgagaa agcctgtggc       120
     gatgtatcag gcctgatcgg aatggttggt ccgcaaacac gaggctcttt ttcaataact       180
     tttgatgagc agttagcact aactatcatg gagcgtatgc ttggcgaacg tccggatagt       240
     ataaatgaag aagtaaccga tatggtaggc gaaattacta atatggttac aggtggcgct       300
     aaaaacttat tgggtcaaaa aggtttcgac tttgatatgg caactccaat agttgtatct       360
     ggtaaagacc atacaattac ccataaaagc caaggtaaaa aaatactcat gccatttacc       420
     tgcgatgcgg gtaacgccaa tattgaagtg agtttcgata agttatga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page